SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012658198.1.62490 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012658198.1.62490
Domain Number 1 Region: 487-706
Classification Level Classification E-value
Superfamily Bet v1-like 2.59e-40
Family STAR domain 0.0054
Further Details:      
 
Domain Number 2 Region: 92-207
Classification Level Classification E-value
Superfamily PH domain-like 8.49e-17
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012658198.1.62490
Sequence length 715
Comment PREDICTED: collagen type IV alpha-3-binding protein [Otolemur garnettii]; AA=GCF_000181295.1; RF=representative genome; TAX=30611; STAX=30611; NAME=Otolemur garnettii; AL=Scaffold; RT=Major
Sequence
MQRSSVLSPPSPCPAPPTLLPVVIRENRRGLSSGGGSGRNAGVTATAAATDGWKGRLPSP
LVLLPRAARCQARRRRRRSGRTSSLVLLPSAPVRALLASPSPDPSPRGLGAASRASQGVG
AGLLLGCRASMSDNQSWNSSGSEEEPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNN
TLSYYKSEDETEYGCRGSICLSKAVITTESGYGSESSLRRHGSMVSLVSGASGYSATSTS
SFKKGHSLREKLAEMETFRDILCRQVDTLQKYFDACADAVSKDELQRDKVVEDDEDDFPT
TRSDGDFLHNTNGNKEKLFPHVTPKGINGIDFKGEAITFKATTAGILATLSHCIELMVKR
EESWQKRLDKEIEKKRRAEEECEKAKMELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAA
LDRQDKIEEQSQSEKVRLHCPTPLPSGDAFSSVGTHRFVQKPYSRSSSMSSIDLVSASDD
VHRFSSQVEEMVQNHMNYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHA
VKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYL
SAIRKIPALTENDPETWIVCNFSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEIS
RDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
Download sequence
Identical sequences XP_012658198.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]