SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012660239.1.62490 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_012660239.1.62490
Domain Number - Region: 70-138
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0018
Family Extracellular domain of cell surface receptors 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012660239.1.62490
Sequence length 147
Comment PREDICTED: lymphocyte antigen 6 complex locus protein G5c [Otolemur garnettii]; AA=GCF_000181295.1; RF=representative genome; TAX=30611; STAX=30611; NAME=Otolemur garnettii; AL=Scaffold; RT=Major
Sequence
MHFMAGPAENRHLETLGLRRTLQALCMVLLTVLVMMSMVFGKIVPVNQKPSQFPKYLRCY
RCLLETKELGCLLGSDICLTPAGSSCITLHIKNSSGSDVMVSDCRSKEQMSDCSYTRASP
VFGFWIFSQCCFLDFCNDPQNRALHTP
Download sequence
Identical sequences H0XPQ0
ENSOGAP00000018091 ENSOGAP00000018091 XP_012660239.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]