SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012661752.1.62490 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012661752.1.62490
Domain Number 1 Region: 1165-1385
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.53e-54
Family DBL homology domain (DH-domain) 0.00026
Further Details:      
 
Domain Number 2 Region: 1375-1533
Classification Level Classification E-value
Superfamily PH domain-like 5.16e-20
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Domain Number 3 Region: 1518-1583
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000109
Family SH3-domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012661752.1.62490
Sequence length 1606
Comment PREDICTED: rho guanine nucleotide exchange factor 5 [Otolemur garnettii]; AA=GCF_000181295.1; RF=representative genome; TAX=30611; STAX=30611; NAME=Otolemur garnettii; AL=Scaffold; RT=Major
Sequence
MEAEEPPHGVFPIPAIAEFSTVPEVPMGSSQIPALEPEAQEGEDLSHPWREECRPFETQQ
RESGDVTDYAVTSMASFPKEGPTHVGTKWETLVTEACDSPEQPKAVPQSPADRQARTIFP
PEPCACPLQGEHLDVVSISSDLDSRVEVEFLPEFTTPMLGSEQAEEKEETTLDTFTPTRY
SPSCKEHPTETSETKDPEDGTVGQEELLFRAVQGSWRPEELWHPQEAQGLEGQGQQKVGL
QGEGALSGDNCDDGLWGQQTQRVEQTDGEEGVQRREQNQAQDDGPPRRMGEREWLPRGLE
GPKDGAWGQEDVKGSEQGQEGQKQGEPSRRDSKELEESRGDSCSEQCQSWVEQSEEVTGK
QRAQGLKGDVLPVDGSEEEPGGWGRGSLARVGEEGGMEEEKEHHGLSTLALVTAELSSPH
DLFPDALYPRMQSPGTQAEPRAEELSPLALPPTLEHIECSHQLVSLRSSFPTGESLDNET
TQDSQQEASELGKGTMSCQQPEEVSANASGTPPRTMDSPPSSLAEVSPVTPSWSSASIPS
DFPSACSLEVSRASLLTDKPSPSGTSKPRPASLHDFPSVEATLDPCASSDGADPDGPFAN
CTGAIPHIRCNSFPGSHRTAQNPDLLGMSLSFSHSELPQRPPKPAIYGSVIPRRDRRSGR
DCNIILESPSALPVSRQDSQELASSVEQPSGPASSQPWEAPLSPDLAAESPACGSSLPFV
SMDMRSKDPLPPPPLEKRHVPPSMVERDGHLCAAVPTLKRHNHAPPLVLGLGLHSPPKGP
RPQIPDPLVSRQHRPLPCTPDSPQHTQTSFSPRLKYNKPLPPTPDMQQSHHSPVSSSISR
RYRPLPPVPIMDPPSEPPPLPPKSRGKSRTPQEGLMNSGSQAKARPVCQDWTVSTAPSAG
RTSWPPAVGRSTESLASTSRSKSEVSPSMAFSNMTNLLRPSSPTTPWTQELPGPTPAIAP
GLSEESEAPARETWRRTVSRDAVNGSRKPALSQARQPEKPSHLHHPQLEKASSWPHRRDP
GRQPGGGSGQAVVPAEGPNKHKGWNRQGLRRPSILPEAASDSQGPAVERFPNPSDTIVFR
EKKPKETSGGFSRRCSKLINSSQVLYQEYSDVFLNKEIQSQQRLDSLAEVPGPMSPRQPR
KALVSSESYLQRLSVASSSSLWQEIPVVRNSTVLLSMTHEDQKLQEAKFELILSEASYLR
SLHVAVDHFQLSTALRATLSNQEHQWLFSRLQDVRDVSTTFLSDLEENLENNIFSFQVCD
VVLSHAPDFRRVYLPYVTNQTYQERTFQSLLSSNSSFREVLEKLESDPVCQRLSLKSFLI
LPFQRITRLKLLLQNILKRTQPGSSEEAEATKAHHALEELIRDCNSNVQRMRRTEELIYL
SQKIEFECKIFPLISQSRWLVKSGELTALEFSVSPGLRRKLNTRPVHLHLFNDCLLLSRP
REGSRFLVFDHAPFSSIRGEKCEMKLHGPHKNLFRLFLLHNAQGTQAEFLFRTETQSEKL
RWISALAMPREELDLLECYDSPQVQCLRAYKPRENDELALEKADVVMLTQQSSDGWLEGV
RLSDGERGWFPMQQVEFISNPEVRARNLKEAHRVKTAKLQLVEQQA
Download sequence
Identical sequences H0X2M0
ENSOGAP00000009313 ENSOGAP00000009313 XP_012661752.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]