SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012662787.1.62490 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012662787.1.62490
Domain Number 1 Region: 68-251
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.19e-74
Family F-box associated region, FBA 0.000002
Further Details:      
 
Domain Number 2 Region: 4-83
Classification Level Classification E-value
Superfamily F-box domain 2.75e-16
Family F-box domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012662787.1.62490
Sequence length 255
Comment PREDICTED: F-box only protein 44 [Otolemur garnettii]; AA=GCF_000181295.1; RF=representative genome; TAX=30611; STAX=30611; NAME=Otolemur garnettii; AL=Scaffold; RT=Major
Sequence
MAVGNINELPESILLELFTHVPARQLLLRCRLVCSLWRDLIDLVSLWKRKCLREGFITED
WDQPVADWKIFYFLRSLHRNLLHNPCAEEGFEFWSLDVNGGDEWKVEDLSRDQRKEFPSE
KVKKYFVTSYYTCLKSQVVDLKAEGYWEELMDTTRPDIEVKDWFAARRDCGSKYQLCVQL
LSSAHAPLGTFQPDPVTIQQKSDAKWREVSHTFSNYPPGVRYIWFQHGGVDTHYWAGWYG
PKVTNSSITIGPPLR
Download sequence
Identical sequences H0X139
XP_003793323.1.62490 XP_012662786.1.62490 XP_012662787.1.62490 ENSOGAP00000008681 ENSOGAP00000008681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]