SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012664671.1.62490 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012664671.1.62490
Domain Number 1 Region: 21-517
Classification Level Classification E-value
Superfamily Sema domain 4.32e-100
Family Sema domain 0.0018
Further Details:      
 
Domain Number 2 Region: 1385-1510,1676-1833
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.71e-33
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 953-1043
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000242
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.071
Further Details:      
 
Domain Number 4 Region: 863-953
Classification Level Classification E-value
Superfamily E set domains 0.000000000000315
Family Other IPT/TIG domains 0.013
Further Details:      
 
Domain Number 5 Region: 1040-1121
Classification Level Classification E-value
Superfamily E set domains 0.0000000000056
Family E-set domains of sugar-utilizing enzymes 0.074
Further Details:      
 
Domain Number 6 Region: 520-571
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000101
Family Plexin repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012664671.1.62490
Sequence length 1900
Comment PREDICTED: plexin-D1, partial [Otolemur garnettii]; AA=GCF_000181295.1; RF=representative genome; TAX=30611; STAX=30611; NAME=Otolemur garnettii; AL=Scaffold; RT=Major
Sequence
CQLPVLLLLLGAARVGALEIQRRFPSPTPTNNFALDGAAGTVYLAAVNRLYQLSGANLSL
EAEAAVGPVADSPLCHAPQLPQASCEHPRRLTDNYNKILQLDPGQGLVVVCGSIYQGFCQ
LRRRGNISAVAVHFPPAAPPAEPVTVFPSMLNVAANHPNASTVGLVLPPAAGAGGSRLLV
GATYTGYGSAFFPRNRSLEDHRFENTPEIAIRSLDARGDLAKLFTFDLNPSDDNILKIKQ
GAKEQHKLGFVRAFLHPPDPPPSAPSYAYLALNSEARAGDKESQARSLLARICLPRGAGG
DAKKLTESYIQLGLQCAGGAGRGDLYSRLVSVFPARELLFAVFERPQGAPAVRAAPAALC
AFRFADVRAAIRAARTACFVEPAPDVVAVLDSVVQGTGPACEPKRNIQLQQEQLDCGAAH
LQHPLSILRPLKATPVFRAPGLTSVAVASVNNYTAVFLGTVNGRLLKISLNESMQVVSRR
VVTVAYGEPVHHIMQFDPADPGYLYLMTSHQMARVKVAACNVYATCGDCVGAADAYCGWC
ALETRCTLQQDCANSSQQHFWTSASEGPGLCPSMTVLPADIDVHREYPGMILQISGSLPS
LSGMEMACDYGNNFRTVARVPGPAFGHQIGHQIAYCNLLPRDRFPPFPPHRDHVTVEMSL
RVNGRNIVGANFTIYDCSRMGQVYPHTACTSCLSTQWPCFWCTKKHTCVSNQSRCEASPN
PMRPQDCPQTLPSPLAPVPTGGSQDILVPLANAAFFQGSALECSFGLEEIFEAVWENESV
VRCNQVVLHTAQKSQVFPLSLQLKGWPARFLDSPDPMTVVVYNCAMGSPDCSQCLGREDQ
GHLCMWSDGCRLRGPMQPLPGACPAPEIREIEPLSGPLDGGTLLTIRGRNLGRRLSDVAH
GVWIGSVACEPLADRYMVSEEIVCATGPAPGLFSDVVTVNASKEGRSRERFSYVLPLVNS
LEPAMGPQAGGTRITIHGSDLHVGSELQVLVNGTDPCTELMRRDSSITCTMPAGALPAAV
PVCVRFEHRGCVHGNLTFWYMQNPVITAISPRRSPVSGGRTITVAGERFHMVQNVSMAVH
HIGREPTLCKVLNSTLITCPSPGALSNASAPVDFFINGRAYADEVAVAEELLEPEEAQRG
SRFRLDYLPNPQFSTAKREKWIKHHPGEPLTLVIHKEQDSLGLQSHEYRVKIGQVACDIQ
IVSDRVIHCSVNESLGATEGQLPITIQVGNFNQTIATLQLGGSETAIIVSIVICSVLLLL
SVVALFVFCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQG
IPFLEYKHFVTRTFFPKCSSLYEESYVLPSQTRNSQGSSPVQETHPLLGEWKIPESCRPN
MEEGISLFSSLLNNKHFLIIFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIMKE
LLVDLIDASAAKNPKLMLRRTESVVEKMLTNWMSICMYSCLRETVGEPFFLLLCAIKQQI
NKGSIDAITGKARYTLNEEWLLRENIEAKPRNLNVSFQGCGMDSLSVRAMDTDTLTQVKE
KILEAFCKNVPYSQWPRAEDVDLEWFASSTQSYILRDLDDTSVVEDGRKKLNTLAHYKIP
EGASLAMSLIDKKDNTLSRVKDLDTEKYFHLVLPTDELAEPKKSHRQSHRKKVLPEIYLT
RLLSTKGTLQKFLDDLFKAILSIREDKPPLAVKYFFDFLEEQAEKRGISDPDTLHIWKTN
SLPLRFWVNILKNPQFVFDIDKTDHIDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYA
KEIPEYRKIVQRYYKQIQDMAPLSEQEMNAHLAEESRKYQNEFNTNVAMAEIYKYAKRYR
PQIMAALEANPTARRTQLQHKFEQVVALMEDNIYECYSEA
Download sequence
Identical sequences XP_012664671.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]