SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012668405.1.62490 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012668405.1.62490
Domain Number 1 Region: 97-274
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.91e-63
Family F-box associated region, FBA 0.0000177
Further Details:      
 
Domain Number 2 Region: 7-70
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000164
Family F-box domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012668405.1.62490
Sequence length 278
Comment PREDICTED: F-box only protein 17 [Otolemur garnettii]; AA=GCF_000181295.1; RF=representative genome; TAX=30611; STAX=30611; NAME=Otolemur garnettii; AL=Scaffold; RT=Major
Sequence
MGARSSRRLQPADPPMALDTLPPELLVQVLSHVPPRGLVTQCRLVCRAWRDVVDGPTVWL
LHLARDRSAEGRALYALALRCLPNSEEDEEFPFCALARYCLRAPLGRNLIFNSCGERGFK
GWEVEHGGNGWAVEKNLTLVPGAPSQTCFVTSFEWCFKRQLVDLVMEGVWQELLDSAQIE
ICVADWWGARENCGCVYRLRVRLLDVYENEVVKFSASPNPVLQWTERGCRQVSHVFTNFG
KGIRYVSFEQYGRDTRSWVGHYGALVTHSSVKVRIRLS
Download sequence
Identical sequences H0WY61
ENSOGAP00000007428 XP_012668405.1.62490 ENSOGAP00000007428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]