SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012682075.1.3086 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012682075.1.3086
Domain Number 1 Region: 218-393
Classification Level Classification E-value
Superfamily MIR domain 4.84e-41
Family MIR domain 0.001
Further Details:      
 
Domain Number 2 Region: 1076-1166
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.32e-17
Family SPRY domain 0.061
Further Details:      
 
Domain Number 3 Region: 3912-3971
Classification Level Classification E-value
Superfamily EF-hand 0.000000000495
Family Calmodulin-like 0.03
Further Details:      
 
Domain Number 4 Region: 637-801
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000229
Family SPRY domain 0.04
Further Details:      
 
Domain Number 5 Region: 435-546
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000288
Family IP3 receptor type 1 binding core, domain 2 0.02
Further Details:      
 
Domain Number 6 Region: 2057-2121
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000719
Family IP3 receptor type 1 binding core, domain 2 0.019
Further Details:      
 
Domain Number 7 Region: 102-183
Classification Level Classification E-value
Superfamily MIR domain 0.0000222
Family MIR domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012682075.1.3086
Sequence length 4831
Comment PREDICTED: ryanodine receptor 3-like isoform X4 [Clupea harengus]; AA=GCF_000966335.1; RF=representative genome; TAX=7950; STAX=7950; NAME=Clupea harengus; AL=Scaffold; RT=Major
Sequence
MAEGGEGEDEIQFLRTDDEVVVQCVAAIRKENCKFCLAAEGLGNRLCFLEPTSEAKYVPP
DLCVCSFVLEQSLSVRALQEMLAKTGPEGLGAVQGGGHRTLLYGHAILLRHSFSGMYLTC
LKTSRSQTDKLSFDVGLQEDTVGEACWWTIHPASKQRSEGEKVRIGDDLILVSVASERYL
HLSMSNENVTVDASFMQTLWNVQPTCSGSNVAVGYVQGGQVMRLFHGHDESLTIPGEEKG
VDQRIVNYEAGKGGSRAKSLWRLEPLRISWSGGNLRWGQPFRLRHLSTGHYLGRTEDQGL
VLLDREQSNTKATAFCFRSSKEKVESGPKRDVEGMGVAEIKYGDSVCIVMHVATGLWVSY
QAPDSKSSRLGPLRRRVVLYPEGHMDDGLILQLCQHEESRAVRIIRNTTLLFSQFIKALD
SLGGEKSNEVSLPVGEVLETLNDLIAYFQQPDSELEHEEKQRQLRSLIKRQDLFKEEGML
TLLSNCIDRLNVYNSAAHFEELAGAEAGEAWKDILNLLYELLASLIRGNRTNCTQFSRKL
DWLVSKLERLESSSGILEVLHCILVESPEALNIIQKAHIKSIIFLLYKHGRNHKILDILC
SLCVCNSVAVRANQNFICDHLLPRRDLLLQSRMVNDVQSMRPNIFLGINEGSAQYKKWYF
ELMIDQVDHFVTSEPTHLRVGWATTEGYAPYPGGGEGWGGNGVGDDLYSYSFDGLHLWSG
RIPRAVASVNQHLLTADDVVSCCLDLGAPSMSFRINGQPVQGMFEDFNMDGLFFPVVSFS
AGVKVRFLLGGRHGDFKFLPPAGYAPCYEALLPKEKMCIEPVKEYKRDHEGVRNLLGTTK
LLSQASFIPIPVDTSQTVLPPHLEHVRDRLAENIHELWGMNKIELGWTYGKVRDDNKRQH
PCLIDFSKLPETEMNYNLQMSSETLKTLLALGCLVSHINPSAEEDLKKIKLPKNYVMSNG
YKPTPLDLSDVKLNPGQDVLVDKLAENAHNVWAKDRIKQGWTYGIQQDLKSRRNPRLVPY
ALLDERTKRSNRDSLREAIRTLVGYGYNIDPPDQETAHGLARQSTEAIRFFRVEKTYAVT
TGKWYFEFEALTGGDMLVGWARPGCRPDVELGLDELSYVFDGFRGRRVHRGSRIFGRSWS
KGDVVGCMINMEDKSMIFTLNGEILITNNGSELCFADFETEDGFIPVCSLGLSQIGHMNL
GKDASTFKYYTMYGLQEGFEPFAVNMNREVTMWFSKRLPTFVIVPEEHPHIEVTRIDGTE
DTPPCLKVTHKTYGTQSSNNDMVFCRLSMPVEFYHGPRMNTEVTEGTEAPKKEDGKIDYG
SITKYYYSLRVFAGQDPNSVWVGWVTPDYHYYTKNFSLSKIRTVTVTLGDERGRVHESVR
RSNCYMVCCGDIVRGLSSARSNVDLEIGCFIDLASGLVSFTANGKELPTSYQVEPNTKLF
PATFVKPTSPNLLQFEFAKVQDAMPLSSAIFKSLHRNPVPQCPPRLGVQTIVSVLWSRMP
NTFLAVETARVSERHGWVVQCLDALQMLAVHIPEENRCVDILELSENETLRQFHYHTLKL
YGALCALGNTRVAHALCSHLDQSQLLYTIDNQYLTGQLREGFYDVLISIHLDTAKEARLM
MKDEYIIPVTAETNSIRLFCDKSKNHTLPGVGLSTTLTPKLTFTPTCFISTKREQHRCSP
LIPLAKLKAKAISMLTEAVHGGGVHIRDPVGGSVEYQFVPILKLIGTLLMMGALTSEEVR
LVLLLIEPNVFRDAEEEPAVEAAPVKEEVTSNEGKAVEAGEEEAKEAKQSAKSLLEKHLP
ESVKLQMCELLHYFCDCELKQRIEAIVAFADTFVSKLQYNQKFRYNELMLALNMSAAVTA
KKTREFRSPPQEQINMLLNFALGDDCPCPEEIQEDLLVFHDDLRIHCGIPIDEEDEEPDT
SIKGRLMALVYKIKGRPQKTEEEPTEQEQAAPTNLKELISQTMVTWAQECLVQDPQLVRT
MFSLLRRQYDGIGELLRSMKKSYTISAASVQDSTNLMASLGQIRSLLSVRMGIEEEKLMI
DGLSDIMNNKVFYQHPNLMRVLGMHETVMQVMVNVLGGDKSHIAFPAMVASCCRFLCYFC
RISQQNQKAMFDHLSYLLENSSVGLASPAMRGSTPLDVAASSVMDNNGLALALEEPELEK
VVTYLAGCGLQSCLMLVAKGYPDIGWNPMEGERYLSFLRFAVFVNGESVEENANVVVKLL
IRHPECFGPALRGEGGQGLLAAMEEAITISEDPALDLPTLPEGGVPEAVEGEEEEEVAHM
GNSIMSFYSALIDLLGRCAPEMHLISKGKGEALRVRAILQSLVPTVNLVGIISIPLKMPV
ANKDGSVTEPDMSASFCPEHKAPMVLFLDRVYGIVNQGFLLHLLEVGFLPDLRASATLDT
DLLSTTETALAMNRYIGSALLPLLTRCAHLFSGTEHYAALIDSTLHIIYRLSKGRSLTKA
QRDANEECIVAICSHLRPSMLQQLLRRLVFDVPLLTEYCKMPIRLLTNHFEQNWKYYCLP
TGLGSYGVASEEELLLIKKLFWGLFDALSQKKYDSDLFKLAMLGLCSISGALPPDFVDAS
PSSTLEKQVSVDTQGNFDPKPISTANISLPEKLDYIANKYAEHSHEKWSSEKLALGWKRG
EKVDNEAKTHPLLQPYKSLSEKERETYRYPVKESLKSMLALNWNIERTKEGEAMFQQRES
EKQRKISESGAYTPTPLGLDNVVLSRELQGMVEIVAENYHNIWARRKRTELMSKGGGTHP
LLVPYDTLTAKEKFRDREKAQELFKFLQVNGYAISRGQWDMEQDSSAAMEKRFASKFLKR
LLGYVDSAQEFIAHLEAMASSGKTDKSPHEQEIKFFAKVLLPLIDQYLKNHCLYFLSTPS
KNLSSSGYATNKEKERLASLFCKLAALVRHRISLFGGDSPTIVSCLHILAQSLDFRTVMK
SGSELVKAGVRTFFENAAEDLEKTMENLKLGKIAQRSQMKGVSQIINYTTVALLPILNAL
FEHVTQHHFGADLLVDDVQLSCYRILTCLYSLGTAKNSYVEKQLPALGECLSTVVGAMPV
AFLEPELNAHNPLSVFNTKTPRERAILSMPDTVEEMCPEMPELNGLLKDISDLAESSARY
SDMPQIIEVTLPMLCTYLSNWWQQGPDNSSDSSSCCTHIASEHLSTILGNILKILNNNLG
IDDAPWMKRLAVYTQPIISMAGSDLLKSHFLPTLEKMKKKTVKVVSEEEALKAETKNDTQ
EAELQVLDEFAVLCRDLYAFYPMLISYVDNYRSKWLKEPDADSTMLFNMVAEVFILWCKS
YNFKREEQNFVVQNEINNLAFLIGDSKTKSGGQDGERKGRRRKGELYSVQTSLIVAALKK
LLPIGLNMCTAGDQELITLAKIRYGLKDTDDEVKEQLRLNLHLQEKSEDPAVQWQLNLYR
DVVVKSEGPPDPDQTVERVQGLSAALFHLEAVELPLRNKKGAVQKLLSKQRKRAVVACFR
MAPLYNIPRHRCINLYFMAYQRFWIEAEEYFFEEKLVQDLAKTPIKVVEEEEEEEAELKP
DPLHQLILHFSHNALTEKSQLDEDPLYIAYADMMAKSCAEDEEEEEDEEGSKTFEEKEME
KQKILYQQARLHARGAAEMVLQMISSSKGHLGPMVTGTLKLGISILSGGNVIVQQKMLDY
LKEKRDAGFFKSLSGLMQACSVLDLNAFERQNKAESLGMMSEEGSSSKVLLNDDFTKDLF
RFLQLLCEGHNADFQNFLRNQTGNTATVNIIISTVDYLLRLQESISDFYWYYSGKDVMDE
AGQFNFAKALNVAKQVFNSLTEYIQGPCIGNQQSLAHSRLWDAVVGFLHVFANMQMKLSQ
DSSQIELLKELMDLQKDMVVMMLSLLEGNVVNGTIGKQMVDTLVESSSNVEMILKFFDMF
LKLKDLTTSDNFKEYDPDRKGFISKKEFQKAMENKKQYTQSEIEFLLSCAEADENHIVNY
EEFVDRFHEPAKDIGFNVAVLLTNLSEHMPHDSRLSTFLDLAESVLSYFEPYLGRIEIMG
SAKRIERIYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGESEKMEMFVNFCEDTIFEM
QLASQISEPDALERTGEEEEEEDEDEEEEEGLEFQSAFSAACTSVKRKISNFRQMLTFRS
MGKQFKTIKKLTIREMISGFFGFFWMLFMGFFKGIYSVIFGFFHIIWTSIFGGGLVEGAK
NIKVTDILGNMPDPTQFGIHGDVLEAEKADSNELVATADIVQMTSGEPMEVDLMMELMGG
PGKREGKHGLELGLGDVCEIKPDESATTTAEKKKSKKAEVTESEPEKADTDTREKEDKTK
EEAPAEPVAKEKPVHKHRRGAAQEGSPTFMANVFAGLAVYKTKMLNYLARNFYNLRFLAL
FVAFAINFILLFYKVAGDGADEEEDSWENGDDDEEDDDDGGMEYYVLQENTGYMAPSLTF
LAIIHTVLSLLCVLGYYCLKVPLVVFKREKEIARSLEFEGIYITEQPSDDDIKGQWDRLV
INTPSFPSNYWDKFVKRKVINKYGDLYGAERIAELLGLDKSALDFDPTIETVVPEPSLVS
WLSSIDTKYHIWKMGVVLTDNSFLYLVWYTVMSILGHYNNFFFAAHLLDIAMGVKTLRTI
LSSVTHNGKQLMLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDDPDMKCDDMMTCYLFH
MYVGVRAGGGIGDEIEDPAGDPSELYRILFDITFFFFVIVILLAIIQGLIIDAFGELRSQ
QDQVKEDMETKCFICGIGNDYFDRTPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQ
ESFVWKMYQERCWDFFPAGDCFRKQYEDQLC
Download sequence
Identical sequences XP_012682075.1.3086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]