SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012692713.1.3086 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012692713.1.3086
Domain Number 1 Region: 283-380
Classification Level Classification E-value
Superfamily Immunoglobulin 5.57e-20
Family I set domains 0.0089
Further Details:      
 
Domain Number 2 Region: 203-296
Classification Level Classification E-value
Superfamily Immunoglobulin 7.72e-16
Family I set domains 0.061
Further Details:      
 
Domain Number 3 Region: 446-736
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.00000000000000445
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.042
Further Details:      
 
Domain Number 4 Region: 31-82
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000222
Family Ovomucoid domain III-like 0.011
Further Details:      
 
Domain Number 5 Region: 128-192
Classification Level Classification E-value
Superfamily EF-hand 0.00000000691
Family Calmodulin-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012692713.1.3086
Sequence length 796
Comment PREDICTED: follistatin-related protein 5 [Clupea harengus]; AA=GCF_000966335.1; RF=representative genome; TAX=7950; STAX=7950; NAME=Clupea harengus; AL=Scaffold; RT=Major
Sequence
MPGFFGHAGAGTACEHKYCGLGRHCVLDQQTGLGECVCLDRCKPHYKPVCGSDGRLYQNH
CELHRASCLGHHRITIMHSEECFYKDDNCRLGDYKKLKNKIVDLHGQRYLAPGDRGDYRD
DMVVRRRLVDMMFKRFDADGNGRVDSSELSQVIKQEGLTKTSSDCTLFDLLKYNDEDDDE
HLIKEEFYTAFDVYQLILPDDQKLSVTTVTVGQSVVLTCGIMGERRPPIIWRRNGQALNS
LELEDINDFGDDGSLYITKVTTTHMGNYSCHADGYERLSQIHTLQVNVPPVIRVHPESQA
REPGVTASLRCHAEGIPDPQLAWLKNGMDIATKISKQLTLQANGSEVHISNVHFEDTGAY
TCIAKNEAGVDEDISSLFVEDSARKTLANILWREEGLGIGNLFYVFYEDGIKVIQPVACE
IQRHIKPSEKLLGRQEEVCPKQEGEEEQKCVWSSAVNVKDKFIYATQPLLNRVLIVDIQS
QKAVQTVTTDAVPVKLHYDKSHDQVWVLSWGDQQKSAPTLQVISQASASSSHHTVHTQPV
GQRFDRVEDFFIPPASLLISHVRFGIIMHKNEPALHKIDLETTSYVKNISLQAYGCVPQA
LAYTHLGGYYFVSCQDDSTGARRPQLVLDSVTDSVIGVNRDVSGTAYVSPDGHHLVTVDD
RDGLMRVQPVSSRGEIGRPFDIHTNLHLSDLAFMPSFTEGGQYNLFGSSGRQTDALFVEL
RSGTVKMIKSLKEPTSTEQWRWSKKNRVMVGSGLFGQYLMSPSQEALFILDGRLDKLNCE
ITDVPQGNTVVWVGEP
Download sequence
Identical sequences XP_012692713.1.3086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]