SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012694166.1.3086 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012694166.1.3086
Domain Number 1 Region: 41-526
Classification Level Classification E-value
Superfamily Sema domain 7.72e-97
Family Sema domain 0.00048
Further Details:      
 
Domain Number 2 Region: 1403-1526,1675-1859
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.1e-33
Family p120GAP domain-like 0.029
Further Details:      
 
Domain Number 3 Region: 866-958
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000255
Family Other IPT/TIG domains 0.041
Further Details:      
 
Domain Number 4 Region: 956-1045
Classification Level Classification E-value
Superfamily E set domains 0.000000000000547
Family Other IPT/TIG domains 0.024
Further Details:      
 
Domain Number 5 Region: 1047-1125
Classification Level Classification E-value
Superfamily E set domains 0.0000000000293
Family E-set domains of sugar-utilizing enzymes 0.039
Further Details:      
 
Domain Number 6 Region: 529-581
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000506
Family Plexin repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012694166.1.3086
Sequence length 1899
Comment PREDICTED: plexin-D1 [Clupea harengus]; AA=GCF_000966335.1; RF=representative genome; TAX=7950; STAX=7950; NAME=Clupea harengus; AL=Scaffold; RT=Major
Sequence
MPSSQKSIPPSIFLLFLGALVPPNSRWSIHPRPASALQIQQAFTSTNETNNFVVDGVSQR
VYLATVNALYQLNSTRLTKEVERRTGPVEDNPLCHAPQLPQAPCEHVKTSTDNHNKLLVF
DREQGVLVTCGSVYQGFCELLRMDNVSQVAVEFPPRAAKTVFPSMLNIAANHPNASTVGL
VFKTHGGNTRLLVGATYTGSGTPYFPQNHSKEDLRFENTPEIAIRSLNTKYLDRLFTYDI
NPSEDNVFKIKQEDKQKNKLNFVHAFTQKNYSYIALNNDANTGHKESQPNSILARICLDT
ESPRRTSEVRKLTESYIQTGLSCGNGNIYKRLVSVYPAEIYSEQTQQQESVLFGVFSNSD
KNSLTALCAFRFDDIEEAIRQGRRNCSNVPNTADVQVLDSVIQGSGSVCISKTNIVLQTE
QLNCGAAHLQHPLALKRPLRATPIYESHGLSAVAVDNVHGHTIVFLGTSNGRLRKLALRG
DLTLAKRPWSLKLPAREPVHHIMTFDPNDRNYLYLMTSHHLLRVRVASCAQYSSCSECLN
AGDAHCGWCTLESRCSIQGECGHSAMPRGWIGIGEGTLQCPSITITPPEISHSADIKDVG
ILINGSIPDLRGLVECDYGRSLSTHATVHLGSGTAHIQTCPLPPRESYPRIPFNRDHITV
PVTIKVNGTSLVSGSFIIYDCERTGKINSKTACSSCLSNGWRCFWDVERGECVSGKDSAQ
GTLLENSTSCPSLKAQEVVPLPSGVTQDFTLELLNVELGAELDCEFGNGRSYVASWLPER
PGFVKCSGVTLSTTEKSQVFQLNLKRRDQDKYIDSPQPITVEVYNCGSGSSDCSQCWGRE
DQGHLCAWCDNTCRPRDQCQYTHTPCPAPEISKVYPLSGPLEGGTLLTVQGRNLGRRAKD
VRVSIGNVQCSVLEDQYTISQRLVCVTGPSEQPMKDGVSISVEENSSGYSAESFTYLEPK
VLSMQPTEGPRSGGTRVTIIGEHLDAGSNVRVRVNGTQDCNILRRSADSIECAMPAAVIA
DSVSVCVEFDGNSCQSLSLSSNYSYETDPHISSIKPTKSYRSGGRPITVTGQDFDLVQTV
SMEVVGVGRVECSVQSPSFILCHSPPSDQSRKAEAKFYLNGVLYVGERLTSSQLGLDEEE
EEEEEEDVQEDEPGPHSGVFPMEYVEDPQFYTASKEKVIKHHPGEPLTLIITKGPTELEL
TQDEYSVTIGSYPCDISFHNDQLFHCTLNASLSSSEKELPVTVCVGNLRSVIARVQLGSK
ELAIVISIVCSVLLLFCTVALVVYCTKSRRAERYWQKTLLQMEEMESQIRDEIRKGFAEL
QTDMTDLTKELNRSQGIPFLEYKQFVTRTFFPKMWSDYERSLVQPVYENDPQGPRAVPET
HPLLQDWQASDTCKPNMEEGITLFSTLLNNKHFLVTFVHALEQQKDFAVRDRCNLASLLT
IALHGKLEYYTSIMKDLLVDLIDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLKER
VGEPFFLLLCAIRQQINKGSIDAITGKARYTLNEEWLLRENIEAKPQNINVSFQGCGMDS
LSVRVMNSDTIGQVKEKILEAFYKNLPFSQWPHAADVDLEWFPSGGGSRILQDLDNTSGM
EDGRKKLNTVLHYQVTRNIKDLDTEKYVHLVMPNDEQHENKRGHRTSHRKKVLPEIYLTR
LLSTKGTLQKFLDDLFQAILTMPDERPPLAIKYFFDFLEEQADKRGITDPDTLHIWKTNS
LPLRFWVNILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAK
EIPEYKKRVQGYYKQIQEMAPLSEQEMNAHLAEESRKYRNEFNTNLALTEIYKYAKRYRN
QVVSALDSNPTARRTQLHHKFEQVIALVEDNIYECSSEA
Download sequence
Identical sequences XP_012694166.1.3086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]