SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012708352.1.37407 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012708352.1.37407
Domain Number 1 Region: 453-587
Classification Level Classification E-value
Superfamily TIMP-like 1.49e-26
Family Netrin-like domain (NTR/C345C module) 0.017
Further Details:      
 
Domain Number 2 Region: 228-324
Classification Level Classification E-value
Superfamily Immunoglobulin 8.89e-20
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 406-460
Classification Level Classification E-value
Superfamily BPTI-like 2.7e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0034
Further Details:      
 
Domain Number 4 Region: 343-401
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000000709
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.018
Further Details:      
 
Domain Number 5 Region: 144-196
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000018
Family Ovomucoid domain III-like 0.037
Further Details:      
 
Domain Number 6 Region: 55-103
Classification Level Classification E-value
Superfamily Elafin-like 0.000000288
Family Elafin-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012708352.1.37407
Sequence length 589
Comment PREDICTED: WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1 [Fundulus heteroclitus]; AA=GCF_000826765.1; RF=representative genome; TAX=8078; STAX=8078; NAME=Fundulus heteroclitus; AL=Scaffold; RT=Major
Sequence
MPEILLQLLQGRHSEDRRGQKQPLLRGTRVFLLVLLTCDLLDVSLSAGATGSTAGHEGFC
PNKLNSNLWVDAQSTCERECNVDEDCAGHEKCCTNVCGLHSCVSARFSDGVPARPDGKEG
GGDGDAAPASAATCEGFICSQQGATCDIWDGQPICKCQDRCEKEPYFTCASDGLTYFNRC
YMDAEACIRGVTLTVVPCRFYLAGPHTSPFPQDTTVSPTPTSSHEDPMPPTLYSNPHHQS
VYVGGTVSFHCDVIGVPRPDVTWEKQSERRERLVMRPDQMYGNVVITNIGQLVVYNAQVW
DTGIYTCIARNSVGVLQADYPLSVVRRADDDFSEDPELPMGRPFSPADCLAEVDTRVCSG
ERHVDWYYDGKLGSCATFSSGGCDDSRNRFETYEECKASCQREGMGICSLPAVQGPCKNW
EARWAWNSLMKQCQPFVYGGCQGNANSFRTKKECEANCPQPKRKPCRTCRMRGKMMPNLC
RSDFAIVGRLTELIEDLDSGLARFSLDEVLRDEKMGLTFFNTKNLEVTIAKIDWSCPCPN
ITMEDNPLLVMGAVQDGMAVIQPDSYVKAIPERRLRRLRDAVKKNACGT
Download sequence
Identical sequences XP_012708352.1.37407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]