SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012714095.1.37407 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012714095.1.37407
Domain Number 1 Region: 113-139
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000379
Family Integrin beta EGF-like domains 0.049
Further Details:      
 
Domain Number 2 Region: 17-42
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000867
Family EGF-type module 0.035
Further Details:      
 
Domain Number 3 Region: 140-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000157
Family EGF-type module 0.039
Further Details:      
 
Domain Number 4 Region: 83-108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000676
Family Integrin beta EGF-like domains 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012714095.1.37407
Sequence length 188
Comment PREDICTED: teneurin-3-like, partial [Fundulus heteroclitus]; AA=GCF_000826765.1; RF=representative genome; TAX=8078; STAX=8078; NAME=Fundulus heteroclitus; AL=Scaffold; RT=Major
Sequence
MSNPFSPLSPVDCIDPSCSAHGVCIHGECHCQPGWGGASCEITKALCPDQCSGHGTYNAE
TTTCACDQNWTGPDCSLEVCEVDCGNHGICYGGACRCKEGWTGTVCDQKACHPLCSKNGV
CKDGKCECDQGWTGEHCNIEGCPGLCNNNGRCTLEASGWHCICQPGWRGAGCHVAMETLC
TDGKDNEG
Download sequence
Identical sequences XP_012714095.1.37407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]