SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012719385.1.37407 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012719385.1.37407
Domain Number 1 Region: 29-513
Classification Level Classification E-value
Superfamily Sema domain 4.05e-99
Family Sema domain 0.00095
Further Details:      
 
Domain Number 2 Region: 1385-1509,1675-1860
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.67e-35
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 855-946
Classification Level Classification E-value
Superfamily E set domains 0.000000000000866
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 4 Region: 516-568
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000209
Family Plexin repeat 0.0017
Further Details:      
 
Domain Number 5 Region: 1040-1118
Classification Level Classification E-value
Superfamily E set domains 0.00000000000726
Family E-set domains of sugar-utilizing enzymes 0.019
Further Details:      
 
Domain Number 6 Region: 946-1038
Classification Level Classification E-value
Superfamily E set domains 0.0000000000126
Family Other IPT/TIG domains 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012719385.1.37407
Sequence length 1899
Comment PREDICTED: plexin-D1 isoform X3 [Fundulus heteroclitus]; AA=GCF_000826765.1; RF=representative genome; TAX=8078; STAX=8078; NAME=Fundulus heteroclitus; AL=Scaffold; RT=Major
Sequence
MPPSMEIAVLLLGVLTLETRRSASALHIQHTFASPNLTNNFVVDPASRKVYLATVNTVYQ
LNGTLCVEVEKRTGPVEDNLLCHAPQLPQAPCEHPKSLTDNYNKLLKLDPEQGFVVVCGS
VYQGFCELRRMGNISEIAVEFPPQGEKTVFPSMLNIAANHPNASTVGLIFKSHGGSTRLL
VGATYTGAGTQFFPKNHSKEDLRFENTPEIAIRSLNVKALSRLFTYNIDPSEDNVFKIKQ
EVKTKNKLNFVHAFIQKTYSYIAFNNDAKMGHKESQPNSVLARICLDSDSPRKSTGPESR
KLTESYIQMPLQCGANGNIYNRLLSVYPAEVHAPGGWEPEPYLFGVFSRADRKTALCAFK
FGDIEEEIRQGRKNCSNSPSSDVQVMDSVIQGSGAVCIQKENLVLQPEQLDCGAAHLQHP
LALRRPLRAVPLFEYPALSSVSVDNVHNQNVVFLGTSNGRLHKLTLLPNMTLTSQRTMKL
PAGESVHHIMTFDPNDSNFLYVMTSHHMLRVKVAECDQWRSCTDCLGAGDPYCGWCTFEN
RCTIQNECTRGLLPRSWITMGEGPQQCPSITLTPPEISISAKIEAVGILINGSIPDLIGS
KVECEYKPGVSTAATVYGLAQIQTCPLPPPENYQPIPPGTDHLTVSVAIKVNGTSVVSGS
FIIYNCERTGRIHPKTSCMSCLSTRWKCYWDQESHLCLSSKDESKLNLLESAASCPSLIP
SETPPYPSGMAQDFTVSLSNIQKEERLECDFGTERRYDTIWLDNSTVKCSGVTLFTNQRS
QIYHLSLRRAGVFSSEREDIFLDSPQPMKVEVYNCEAGSSDCSQCWGREDQRHLCGWCEN
SCRLRDNCQPIRDVCPAPEIHKIHPLRGPVEGGTLLTVQGRNLGRRPAGLNITIGDVACD
LLPERYTVSVELVCRTGKSERDGTDSVRVDVDQSGTGASKESFAYLVPSVESIYPEKGSR
SGGTRVTIHGEHLDIGSEVRVKVNKTQECTITEKMDQMIKCIMPPSLEADAVPVTATVCV
EFEDRPCQEKELSVMYTYEKNPTISSIHPTKSFLSGGRIITVKGQGFDLVQSVTMHVLEI
GQTNCTVLSPSTITCLSPESSHCQETSVQFVLNGVRYAGDSPSSADDRPEEEDGEPHEEH
FQLGYVEDPQFFTANKDKQIKHHSGEPLTLIINQKVPSELELVPEEYSVMIGSYPCNISF
HNDQLFHCTINGQLSSSDSELPVTVQVGNFRHMITKVQLGGSELAIVVSIVVCCVLLLLC
TVALVVYCTKSRRAERYWQKTIVQMEEMESQIREEIRKGFAELQTDMTDLTKELNRNQGI
PFLEYKQFVTRTFFPKMYSDYEKSLVQPTQDNDSLGPRALPETHPLLQDWQANNTTRPNV
EEGITLFSTLLNNKHFLVTFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIMKDL
LVDLIDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAIKQQIN
KGSIDVLTGKARYTLNEEWLLRENIEAKPQNINVSFQGCGMDSLSVRVMNTDTICQVKEK
IIEAFYKNLPFSQWPRAEDVDLEWFDSGSNSKLLQDLDNSSVMEDGRKKLNTVFHYLIPE
GASLAMSMKDKKESTLERVKDLDTEKYVHLVLPHDELIETKKSHRHSHRKKVLPEIYLTR
LLSTKGTLQKFLDDLFLAILSIPPDRPPLAIKYFFDFLEEQADKRGITDPDTLHIWKTNS
LPLRFWVNILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAK
EIPEYKKRVQCYYKQIQDMPPLSEQEMNAHLAEESRKYRNDFNTNLALSEIYKYAKRYRN
QVLNALEANPTARRTQLHHKFEQVIALVEDNIYECCSEA
Download sequence
Identical sequences A0A146NXC4
XP_012719385.1.37407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]