SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012735543.1.37407 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012735543.1.37407
Domain Number 1 Region: 218-395
Classification Level Classification E-value
Superfamily MIR domain 2.88e-46
Family MIR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 1077-1169
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000243
Family SPRY domain 0.074
Further Details:      
 
Domain Number 3 Region: 650-801
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000562
Family SPRY domain 0.058
Further Details:      
 
Domain Number 4 Region: 3766-3844
Classification Level Classification E-value
Superfamily EF-hand 0.000000729
Family Calmodulin-like 0.036
Further Details:      
 
Domain Number 5 Region: 101-183
Classification Level Classification E-value
Superfamily MIR domain 0.0000235
Family MIR domain 0.026
Further Details:      
 
Domain Number 6 Region: 1916-1981
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000301
Family IP3 receptor type 1 binding core, domain 2 0.025
Further Details:      
 
Domain Number 7 Region: 435-547
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000719
Family IP3 receptor type 1 binding core, domain 2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012735543.1.37407
Sequence length 4725
Comment PREDICTED: ryanodine receptor 3-like [Fundulus heteroclitus]; AA=GCF_000826765.1; RF=representative genome; TAX=8078; STAX=8078; NAME=Fundulus heteroclitus; AL=Scaffold; RT=Major
Sequence
MAEGGEGEDEIQFLRTDDEVVLQCVACIQKENRKFCLAAEGLGNRLCYLEPTSEAKYVPP
DLCICTFVLEQSLSVRALQEMLAKSGQNGEGAAHSGGHKTLLYGHAILLRHTFSSMYLAC
LKTSRSQTDKLSFDVGLQEDSTGEACWWTIHPASKQRSEGEKVRIGDDLILVSVSSERYL
HLSISNGNIQVDASFMQTLWNVHPVCSGSNIEEGYLLGGHVMRLFHGHDEVVSIPGSDQS
EEQQRIVNYETGKAGAKARSLWRLEPLRISWSGSHIRWGQPFRLRHLTTGHYLALTEDRG
LVLQDRERSDTISTAFCFRASKEKLEQSPKRDIEGMGVAEIKYGDSLCFIMHIATGLWLS
YQAPDVKSTRLGPLKRRACLHSEGHMDDGLTLQRCQHEESRAARIIRNTTLLFNRFIRDL
DCLSIKNRTLVALPVEEVLQTLNDLITYFQLPDVELEHEERQIKLRSLKNRQNLFKQEGM
LTLVSNCIDRLNVYNSAAHFGECAGSEAGAAWKDILNLLYELLAALIRGNRNNCTQFSNN
LDWLVSKLERLESSSGILEVLHCILIESPEALNIIQKGHIKSIISLLYKHGRNHKILDVL
CSLCVCNGVAVRTNQNLICDHLLPKRDLLLQSQLVNDVQSMRPNIFLGVSEGSAQYKKWY
YELMIDQVDHFVTSEPSHLRVGWANTKGYAPYPGGGEGWGGNGVGDDLYSFGFDGLHLWS
GRIPRAVASVNQHILTSEDVVSCCLDLGAPSISFRINGQPVQGMFENFNTDGLFFPVVSF
SAGIKVRFLLGGRHGDFKFLPPSSYAPCYEALLPKEKMRVEPVKEYKRDMEGVRDLLGTT
QFTSQASFIPTPVETSQVVMPSHLEKVRDKLAENIHELWGMNKIELGWTYGKIRDDNKRH
HPCLVDFSKLPETEKNYNLQMSTETLKTLLALGCRIVQVNPNAEDSLKKIKLPKNYMMSN
SYKPSPLDLSSIKLTPGQELLVDKLAENAHNVWAKDRIKQGWTYGIQQDLKSKRNPRLVP
YVLLDERTKKSNRDSLREAIRTLIGYGYNIEPSDQEGGQVAERLSIDKIRFFRVERTYAV
KTGKWYFEFEAVTGGDMRVGWARPGCKPDVELGTDKLAFVFDGFRGHCLNMGSRLFGRCW
HAGDVVGCMINMEDKSMIFTLNGEILITTKGSELCFTDFETEDGFIPVCSLSLAQVGRMN
LGKDASTFKYYTTCGLQEGFEPFAVNMNREVTMWFSKRLPTFVNVPKDHNHIGVTRIDGT
IDSPPCLKVTHKTFGNQNSTADMVFCRLSMPVEFHSFFKQSPVTDINGVHEEDLLKVKHS
LYLGSQSSYSFAYFPDGALTSVEPNTKLFPAVFVRPTSPNLFQFELAKIKNAMPLSSAVF
KSELKNPVPQCPPRLDVQTINAVLWSRMPNIFLKVETSRVNERQGWAVQCVEPLQMLAVH
IPEENRCVDIMELSEQEELRTFHYHTLKLYCALCALGNTRVAHALCSHVDQSQLLYTIDN
QYLSGMLREGFYNVLISIHLETAKEARLMMKDEFIIPVTAETRSIRLFSSASKKHSLPGV
GLSTSLKPRLNFTPPCFISTKRDYLFSPQIPLDALKEKAILMLTEAVQGGGHHIRDPVGG
GVEYQFVPILKLISTLLTMGVLGSEDVQKILLLIDPNVFRDTRQEGSAGPTDKEGLTGAE
GKAVEAGEEEAAKEAKQPVKGLLEKRLPEPVKRLMCELLHYFCDCELKHRIEAIVSFSDS
FVSKLQHNQKFRYNELMLALNMSAAVTAKKTKEFRSPPQEQKNSSQPHVFEEKMPESSVV
TLSDLNRTSASANLKELISQTMVSWAQECHIQDPKLVRKMFSLLRRQYDSIGELLRAMRK
TYTISAASVQDTINLLASLGQIRSLLSVRMGKEEEKLMIDGLSDIMNNKVFYQHPNLMRI
LGMHETVMEVMVNVLGGDKSQEIAFPKMVASCCRFLCYFCRISRQNQKAMFDHLSYLLEN
SSVGLASPAMRGSTPLDVAASSVMDNNGLALALEEPDLDKVVTYLAGCGLQSCPMLLAKG
YPDIGWNPIEGERYLSFLRFAVFVNGESVEENSSVVVKLLIRRPECFGPALRGEGGNGLL
AAMKEAIKISETPALDLPGSVHRVSSDLSADGDDEEEVVHMGNAIMSFYSALIDLLGRCA
PEMHLINKGKGEALRIRAILRSLVPTEDLVGIISIPLKTPILNKDGSMTEPDMSASFCPD
HKAPMVLFLDRVYGIEDQSFLLHLLEVGFLPDLRAATTLDTEVLCTTETALAMNRYIGSA
MLPLLTRCAPLFAGTEHHAILIDSTLHTIYRLSKGRSLTKAQRDAIEECLLSICKHLRPS
MLQQLLHRLVFDVPLLTEYCKMPLRLLTNHYEQNWKYYCLPSGWGSFGTASEDELLLTKR
IFWGVFDSLSQRKYDPELFKMAMPCLSAIAGALPPDYVDASISTAVEKPVSVDAQGNFDP
KPINTANIVLPEKLEHFANKYGEHCHEKWSAEKVLLGWKYGDCVDEKAKTHPQLRTYKAL
TEKEKEIYRLPIRDSLKSMLAMGWTVDRTKDGECMSLQRENEKMRKISQASQANGFNPSP
IDTSNVILSRELQGMVEVIAENYHNIWAKKKKNDLGSRGGGTHPLLVPYDTLTAKEKARD
REKALDLFRFLQINGYSITRGLKDLEQDSSSMEKRFSYKFLKKLLKYVDSAQDFIAHLEA
MAASGKTDRSPHEQEIKFFAKVLLPLIDQYFKNHSLYFLSSPNKNLSSSGYASNKEKEMV
ASLFCKLAALVRHRISLFGSDSTTMVSCLHILAHTLDTRTVMKSSSEQVRVGLRTFFENA
AEDLEKTFENLKLGKFTHSRSQMKGVSQNINYTTVALLPILTALFEHITQHHFGIDLLLD
DVQVSCYRILTSLYALGTGKNIYVERQLPALGQCLATLAGAMPVAFLEPKLNTHNPSSVF
NTKSARDRAVLGIRESVEEMCPGMPRLDGLMKDINDMADSGARYTEMPHVIEVVLPMLCN
YLSYWWEKGPENQAVSVGSICCTTVTSEHLSLILGNILKILNNNLGIDEASWMKRIAVYV
QPIISKARADLLKSHFLPTLEKLKKKTVKVVAEEELLKADCKGDTQEAELLILDEFAVLC
RDLYAFYPMLIRYVDNNRSRWLKEPDSDSNDLFRMVAEIFILWCKSHNFKREEQNFVVQN
EINNLSFLTGDNKTKMSKSFKEKSGGQDQERKHKKRRGEFYSIQTSLIVAALKKMLPIGL
NMCTPGDQELISLAKTRYLMKDTDEEVKDHIRQNLHLREKSEDPAVRWQLNLYKDIVMRI
ESPPDPERVVDRIQRISAAIFNLEQVEQPLRSKKCVWQKLLSKQRKRAVVACFRMAPLYN
LPRHRSINLFLLAYQSIWIETEEYSFEEKLVQDLAKTQPKVEEEEEEEVRKQPDPLHQLI
LHFSHNALTECSSLEEDPLYIAYADMMAKSCAEGEEEEEGKEKTFEEKEMEKQKMLYQQA
RLHDRGAAEMVLQMISASKGRLGATVTFTLKLGISVLNGGNILVQQKMLDYLKEKRDVGF
FKSLSGLMMSCSVLDLNAFERQNKAEGLGMVTEEGSINVSERGSKVLQNDEFTKDLFRFL
QLLCEGHNNDFQNFLRTQTGNTTTVNIIISTVDYLLRLQESISDFYWYYSGKDIIDEAGQ
RNFSMALSVAKQVFNSLTEYIQGPCIGNQQSLAHSRLWDAVVGFLHVFANMQMKLSQDSS
QIELLKELLDLQQDMIVMMLSLLEGNVVNGTIGKQMVDTLVESSSNVEMILKFFDMFLKL
KDLTTSDSFKEYDSESKGVISKKDFQKSMENQKQYSQSEIEFLLSCAEADENDMFSYKQF
VERFHEPAKDIGFNVAVLLTNLSEHMPHDARLSTFLNLAESVLSYFEPFLGRIEIMGGAK
RIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGESEKMELFVNFCEDTIFEMQLA
SQISEPDPVEHSDENEDESQSVVENQEEEEEENVMMESSSAFTIACVSLRKSLSHFRQLL
TLKSMKRQYRRFRKMSVREMVRGFFSFFWMIIIGLFHFIYSVVWGFFHILWTTMFGGGLV
EGAKNMKVTDILGNMPDPTQFGIHGDVLETEKMEANDASALEEMGQMSQGDAAEADLMEE
LLSIQPKREGKHGAEPGLGDVSEVVVGDAPSIASAVRQKKAQMAAKKNTSNGDYKSDSEK
GDSEDGEKKDHDKAKDDAPAQPPGEERRAPKKRLGPRKEPPEAFMASFLAGLEIYQTKML
NYLARNFYNLRFLALFVAFAINFILLFYKVTGDYSEDEDPWTRRGRVGEEEDEGALEYFV
LQESTGYMAPTLCCLAILHTIISFLCVVGYYYLKVPLVVFKREKEIARKLEFAGLYITEQ
PSDDDIKGQWDRLVINTPSFPNNYWDKFVKRKVIKKYGDLYGAERIAELLGLDKSALDFN
PTEETVAKEASLVSWLSSIDTKYHVWKMGVVFTDNSFLYLVWYTTMSILGHYNNFFFAAH
LLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSADDDEP
DMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDPYELYRILFDITFFFFVIVILLAII
QGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTTPHGFETHTLQEHNLANYLFFL
MYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQLG
Download sequence
Identical sequences XP_012735543.1.37407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]