SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012762056.1.2076 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012762056.1.2076
Domain Number 1 Region: 3-85
Classification Level Classification E-value
Superfamily RING/U-box 1.49e-24
Family RING finger domain, C3HC4 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012762056.1.2076
Sequence length 89
Comment anaphase promoting complex subunit, putative [Plasmodium reichenowi]; AA=GCF_001601855.1; RF=representative genome; TAX=5854; STAX=5854; NAME=Plasmodium reichenowi; strain=SY57; AL=Chromosome; RT=Major
Sequence
MVHITVKRIHAVARWKWIGSTIDSVCAICNSSLENTCTTCMRPGNGCPPAFGKCGHHFHL
HCMEKWIKQNKLTCPCCRADWYYETQQLN
Download sequence
Identical sequences A0A024VAI6 A0A024VIN5 A0A024WBG6 A0A024WT32 A0A060RV18 A0A0L7K7K4 C6KT81 W4ILN6 W4IUR8 W7FGM7 W7G9X4 W7JME2 W7K1H6
PFF1180w PFHG_00597T0 gi|46361193|emb|CAG25057.1| gi|86171514|ref|XP_966227.1| 5833.PFF1180w-1 XP_012762056.1.2076 XP_966227.1.26446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]