SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012763111.2.2076 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012763111.2.2076
Domain Number 1 Region: 388-487
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 2.03e-17
Family Cdc48 domain 2-like 0.002
Further Details:      
 
Domain Number 2 Region: 590-635
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000101
Family RING finger domain, C3HC4 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012763111.2.2076
Sequence length 637
Comment RING zinc finger protein, putative [Plasmodium reichenowi]; AA=GCF_001601855.1; RF=representative genome; TAX=5854; STAX=5854; NAME=Plasmodium reichenowi; strain=SY57; AL=Chromosome; RT=Major
Sequence
MNSYKSSTSKHINFINNVNMKRRKQVIEKKNILEKVHILPIKKNVYNFTKLYQKLNSLIN
EECILYEGFIINMNEHDIKEEEDERINKRNNCVTNKECANYKNYNSLNVNNINDDEKETH
DYNIDIEEMNTDNTHDKKETIKTKNIDNHNILNNEQQRPTFEYKNNFHNDTDYIIINCVP
STGILSHDTLIYTDGKYVDNLRKIHILIIKDKHYKKYEKKCQKYFGSIKKYLLKKSNQIF
HEAFSFVSYSLDCFSYKLSTKDGTEKKDSDDQLINIDSSDDVANINSCVQVDKCNNYDQL
AKYTNYDEVANIDNYREVKKNKKENIAVDKILMNYLKPYFRKNQNKLYYSGKLFLINNFT
FLTLKIDSDVNVGFIDKNTEIILSVDTYEQYKNVHIVPMYDTLPTTYNYDLFMDYVKPYI
ERHYLNVYSIHDTFFYKGVQFKIMGIDPVNIKYGKGRISCNTFIYTEGSIKPTFFDVISK
ESINYIRSLPFEYKPYAILNILQHLDSDSLLRLFPSSNINIRENHKKEEKLLEQLTKHKY
IFNKNFKNNYTKNSLENNDSKNKENYHHINRKRELHTTTSTLKSNLINEQCAVCFEYFQD
YDKCIKLTCLHTYHWKCVKNWFKFNLTCPCCRYKLNF
Download sequence
Identical sequences A0A151LEZ1
XP_012763111.2.2076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]