SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012781282.1.84141 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012781282.1.84141
Domain Number 1 Region: 39-535
Classification Level Classification E-value
Superfamily Sema domain 2.88e-100
Family Sema domain 0.0017
Further Details:      
 
Domain Number 2 Region: 1405-1530,1697-1853
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.1e-33
Family p120GAP domain-like 0.021
Further Details:      
 
Domain Number 3 Region: 877-968
Classification Level Classification E-value
Superfamily E set domains 0.000000000000153
Family Other IPT/TIG domains 0.012
Further Details:      
 
Domain Number 4 Region: 967-1057
Classification Level Classification E-value
Superfamily E set domains 0.000000000000496
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.054
Further Details:      
 
Domain Number 5 Region: 1054-1136
Classification Level Classification E-value
Superfamily E set domains 0.00000000000446
Family E-set domains of sugar-utilizing enzymes 0.074
Further Details:      
 
Domain Number 6 Region: 538-589
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000262
Family Plexin repeat 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012781282.1.84141
Sequence length 1921
Comment PREDICTED: LOW QUALITY PROTEIN: plexin-D1, partial [Ochotona princeps]; AA=GCF_000292845.1; RF=representative genome; TAX=9978; STAX=9978; NAME=Ochotona princeps; AL=Scaffold; RT=Major
Sequence
SPPPPPSPRRPLLGPPLCPLPLLLLLFLGAARAGALEIQRRFPSPTPTNNFALDGAAGTV
YLAAVNRLYQLSGANLSLEAEAAVGPVADSPLCHAPQLPQASCEHPRRLTDNYNKILQLD
PGQGLVVVCGSIYQGFCQLRRRGNISAVAVAFPPAAPPAAPVAVFPSMLNVAANHANAST
VALVLPPAAGTGGSRLLVGATYTGYGSAFFPRNRSLEDHRFENTPEISIRSLDARGDLAK
LFTFDLNPSDDNILKIKQGAKEQHKLGFVRAFLHPPEPRPGVPSYAYLALNSEARAGDKE
SQARSLLARICLPRGAGGDAKKLTESYIQLGLQCAGGAGRGDLYSRLVSVFPTRELLFAV
FERPQGTPAARAAPAALCAFRFADVRAAIRAARTACFVEPAPDVVAVLDSVVQGTGPACE
RKRNIQLQPEQLDCGAAHLQHPLSILQPLRSTPVFRAPGLTSVAVASANNYTVVFLGTVN
GRLLKINLNESMQVVSRRVVTVAYGEPVHHVMQFDPADPGYLYLMTSHQMARVKVAACEV
YSTCADCVGAADAYCGWCTLETRCTLQQDCANASQPHFWTSASEGPGRCPAMTVLPAEID
VRQEYPGMILQISGSLPSLRGVEMACDYGNHVRTEARVPGPAYGHQIAYCNLLPRHQFPP
FPPHQDHVTVEMSVRVNGHNIVSANFTIYDCSRVGQVYPHTACTSCLSAQWPCFWCLQQH
ACVSNQSRCDASPNPTNPQDCPQILPSLLTPVPTGGSQDILVPLANAAFFHSAALECSFG
SEEVFEAVWVNESVVRCNQVVLHTTQKSCGFPLSLQLKGWPARFLDSPDPITVEVYNCAM
GSPDCSQCLGREDLGHLCVWSDGCRLRGPLQPLPGPCPAPEIRAIEPLSGPLDGGTLLTI
RGRNLGRRLSDVAQGVWIGSVACEPLADRYMVSEEIVCATGPAPGVFSDVVTVNASKEGK
SRERFSYVLPQVQFLEPEVGPKAGGTRITIHGSELHVGSELQVLVNSSDPCTELTRTDTS
ITCTMPAGALAVPVPVCVRFERRGCVHGNLTFWYMQNPVITAISPRRSPVSGGRTITVAG
ERFHMVQNVSMAVHHIGREPTLCKVLNSTLITCPSPGALSNASAPVDFFINGRAYTDEAA
VAEELLDPGEAWRGRRFRLDYLPNPQFSTAKREKWIKHHPGEPLTLVIHKEQDSLGLESH
EYRVKIGQVACDIQVISDRVIHCSVNESLGTAEGQLPITIQVGNFNQTLATLQLGGSETA
IIVSIVICSVLLLLSVVALFVFCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQT
DMTDLTKELNRSQGIPFLEYKHFVTRTFFPKPGVPWLCSFLYGECXILPSHLLTPQGSSP
VQETHPLLGEWKVPESCRPNMEEGISLFSSLLSNKHFLVVFVHALEQQKDFAVRDRCSLA
SLLTIALHGKLEYYTSIMKELLVDLIDASAAKNPKLMLRRTESVVEKMLTNWMSICMYSC
LRETVGEPFFLLLCAIKQQVNKGSIDAITGKARYTLNEEWLLRENIEAKPRNLNVSFQGC
GMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEWFASSTQSYILRDLDD
TSVVEDGRKKLNTLAHYKIPEGASLAMSLTDKKDSNSLGRVKDLDTEKYFHLVLPTDELA
EPKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPPLAVKYFFDFL
EEQAEKRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHIDACLSVIAQAFID
ACSISDLQLGKDSPTNKLLYAKEIPEYRKIVQHYYKQIQDMTPLSEQEMNAHLAEESRKY
QNEFNTNVAMAEIYKYAKRYRPQIMAALEANPTARRTQLQHKFEQVVALMEDNIYECYSE
A
Download sequence
Identical sequences XP_012781282.1.84141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]