SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012791350.1.94378 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012791350.1.94378
Domain Number 1 Region: 15-121
Classification Level Classification E-value
Superfamily SRCR-like 6.67e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000648
Further Details:      
 
Domain Number 2 Region: 239-348
Classification Level Classification E-value
Superfamily SRCR-like 4.71e-44
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 
Domain Number 3 Region: 123-233
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-35
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 4 Region: 362-472
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-33
Family Spermadhesin, CUB domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012791350.1.94378
Sequence length 765
Comment PREDICTED: deleted in malignant brain tumors 1 protein-like, partial [Sorex araneus]; AA=GCF_000181275.1; RF=representative genome; TAX=42254; STAX=42254; NAME=Sorex araneus; AL=Scaffold; RT=Major
Sequence
LWTETSTGTTGTDSGLALRLVNGGNRCQGRVEVLYQGSWGSVCDDGWDTLDANVVCRQLG
CGWALSAPGSARFGQSSGPILLDDVSCTGHESYLWSCRHRGWGSHNCNHGEDAGVICSGP
SHCGGLLTSASGNFSSPNYPGFYPNNAECVWEIQVSPNSRVNLGFSSLRLEVNVNCTLDY
VEVYDGWVGSGRLLGRVCDATPRVFTSSANSLTVRFRSDHSFQNTGFTAWYNSYPRDARL
RLVNSNSSHSQCEGRVEVYQGGSWGTVCDDGWSMQDAQVVCRQLGCGQALSAPGNAYYGS
GSGPITLDNVECGGTESTLWQCRHNGWFSHNCGHHEDAGVRCSGYLTTTPDYDPVTTTSG
SRPCGGLLTQSSGQFSSPSYPNNYPNHANCVWDIEVANNDLVTVVFSDVQLESNCNFDYV
ELYDGPYHSSPLLARVCSGDKGSYTSSSNFMSVRFVSDGSVSRRGFLATYYSSPSNKSTE
LLCRPDHMQASVSRKLLASLRYGPSDLAIPGWAHNSQCQSRVTPTHVVFTIPYTGCGTTK
EVDNDTITYTNFLRATVSRGVITRKKDLHIHLQCKMLQDTWVDNIMFVTNDTVEVQEVQY
RNFDVNISFYTSASFSRPVTSSPYYVDLDQALFVQAEILHNDSALALFVDTCVASPDAHD
FTSVSYDLVRNGCWKDETYRTLAQPAPRIARFQFSSFHFLKRFPSVFLRCKMVVCRANDY
SSRCYRGCVVRSKRDLSPELEKVDVVLGPIQLQPPHAGTSSPGSS
Download sequence
Identical sequences XP_012791350.1.94378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]