SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012798838.1.65645 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012798838.1.65645
Domain Number 1 Region: 98-278
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.49e-22
Family UAS domain 0.018
Further Details:      
 
Domain Number 2 Region: 338-433
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000336
Family UBX domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012798838.1.65645
Sequence length 488
Comment FAS-associated factor 2 [Schistosoma haematobium]; AA=GCF_000699445.1; RF=representative genome; TAX=6185; STAX=6185; NAME=Schistosoma haematobium; AL=Scaffold; RT=Major
Sequence
MSGNDNIDEAHALSESEAQDVQHLREIAGGIGYLDALKLLEESSWNLERAVHKLMGFEDS
GLRQRGAASRISSVPQFYRNYFPYQASFLWSDPRNQVTDPVGDVRNFIQHFKETYGSVNT
SFDVDGNSNPTESSTSDSFPPFFEGTYADAVQEAKQSLRFLIVYLHGDSHEDTHRFCKDI
LQSEDVLRFLRNSNELLFWGCNIESPEGYRVSRTLREHTYPFIGVIGLTNIPISESGVYS
GSSTRMALLGRIEGVLEPSELVDQLNSILNEHQTAIITARLDRFIILRSTPSFNRSEREM
NAQLRREQDLAYEASLAEDRAKVAAREAQQRSAALVAEQLAKDAKRKEDLKKAHINRKRI
WQSRLPPPPKFEEGSTVQLSFKMPRGSRVSRVFNLNDSIKLLYYFVLSQDDSPTEFEVQS
NFPKRIIPCQPFEESDVEDYIDTPDNKMDCDEPEVITDWSRKCQNDPPSFFDIDLTRPEM
LFVLNKDA
Download sequence
Identical sequences A0A095C9U0
XP_012798838.1.65645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]