SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012820319.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012820319.1.99540
Domain Number 1 Region: 230-474
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.05e-70
Family Nuclear receptor ligand-binding domain 0.000000000603
Further Details:      
 
Domain Number 2 Region: 120-208
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.63e-28
Family Nuclear receptor 0.00000495
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012820319.1.99540
Sequence length 476
Comment PREDICTED: thyroid hormone receptor beta isoform X1 [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MNYCMQEFYDVHQAAANNCCMQPPDYCTYIEDSQSYSSSEAQVLHNNNIYMEQAWAVNQP
YTCSYPGNMFKSEYSEMDMALNQYSQPEYFTEEKTTFPQRQSPMYSQKKGYIPSYLDKDE
LCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPSYSCKYEGKCVIDKVTRNQCQECR
FKKCIAVGMATDLVLDDSKRLAKRKLIEENREKRRKDEIQKSLVQKPEPTQEEWELIQVV
SEAHVATNAQGSHWKQKRKFLPEDIGQAPIVNAPEGGKVDLEAFSQFTKIITPAITRVVD
FAKKLPMFCELPCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGG
LGVVSDAIFDLGVSLSSFSLDDTEVALLQAVLLMSSDRPGLTSVERIEKCQEGFLLAFEH
YINYRKHNIAHFWPKLLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
Download sequence
Identical sequences E7CYG4
gi|302954190|gb|ADL74878| XP_012820319.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]