SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012822790.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012822790.1.99540
Domain Number 1 Region: 441-656
Classification Level Classification E-value
Superfamily ARM repeat 0.000000037
Family Armadillo repeat 0.044
Further Details:      
 
Domain Number 2 Region: 5-152
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000425
Family APC10-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012822790.1.99540
Sequence length 944
Comment PREDICTED: centrosomal protein of 104 kDa isoform X1 [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MPHKLGFVVVSSSGHEDGFSAKELMVHAPTVSGWRSPRFCQYPQEIIIQMVERCRIRKLQ
LLAHQYMISSKIEFYISESLPDYFVPYQSERFRRLGYVSLSDNEKTGYKARELKSVYVEA
VGQYLKLIFHKNYSNRYNLYNQVALIAINIIGDPVDFNEESNMPSREKLIDQYLGNGSDD
SALDASYTGKLDAISPLDDLAFDMYQDPEVAQIIRKLDEKKQEAVRHERYDYAKKLKQAI
ADLQKVGERLGRYEVEKRCAVEKEDYDLAKQKKQQMEEYRQKVYQQLELHDLLDIALIRR
GSETSLDPIESVSPQQHRALSPPQPEKERSTEKKPKKEQPAVTEKPPKVLSPKPILESRR
SPSPPPAASPALVAPNINVDALPYDERPLPAQRKNKEDSFSYLEPEVNEEPVLDTPRTRI
TGEPEPLTEKALREAGFAIEVFGEALVAGAYSKTWSYREDALIAVSKKLADIASGMSKDD
LKNLLRAAMFLVRRAIKDKVTSVFQASLRLLKMIITDYIPKHKLGKGETTHCVEKCLPDL
LVRTGDSTARHRLISSNFIQEMALFKEVKPLQIIPTHLVQPLKPTMPSRLAQSQVDLLEN
LLKELGVESSGFTVDNVMKFAVGALEYTISEVRDKAVQIILYLYKQHPSQVLEYMPTEDS
SARKNILYKTLFEGFAKIDGRPTDSELKAQKKKMAEEAERQKKEEIKALQEQLAALKEIQ
TEVQTGKAKDVHVNKSKTDERSRKVAGSPNADTSDAVDNYLDNLCIFCGERDESFTDEGL
DLHYWKNCPMLKRCEHCKQVVEIASLTDHLLTECDQKDSFGKCQRCSEAIPKDVLLEHVK
AKSCNAAKGEKVANHCPLCHENFSPGEEAWKSHLMGKEGCRMNPRRTQALQRIQLALQAA
KAPGSTVTKAGTGGPRLRAPLAGSRIPAPRAGLNKTTSKAQPKR
Download sequence
Identical sequences XP_012822790.1.99540 XP_017951483.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]