SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012824158.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012824158.1.99540
Domain Number 1 Region: 139-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000149
Family EGF-type module 0.011
Further Details:      
 
Domain Number 2 Region: 112-143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000602
Family EGF-type module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012824158.1.99540
Sequence length 279
Comment PREDICTED: epidermal growth factor-like protein 7 isoform X1 [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MWKVSCLVTGYLLILAVGGAAEHLYRTGRRICSAAGHAGTVSVTQSFVQPVHSPIVTLCD
GHRICSTYRTTYKVSYRQVSRKTSLPLYSCCPGWRKIEAHTHSCGQAGCRLPCRNGGTCV
ASNKCECSAGWRGIYCQTDVDECSDGSHQCAQLCVNSAGSYHCGCLGGYRLMADGKSCDL
VPKPTVPPASPPSVHEQGLPHSVREEMAELRNKIEVLEQKLHLLLTPFQSLTTTSPDARA
DPIALLTHSLQQLDRIDSLSEQISFLEERLETCSCKTEL
Download sequence
Identical sequences Q0IHL2
ENSXETP00000001685 ENSXETP00000001685 8364.ENSXETP00000001685 NP_001072909.1.99540 XP_012824157.1.99540 XP_012824158.1.99540 XP_017945364.1.99540 gi|114108163|gb|AAI23102| gi|118404684|ref|NP_001072909|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]