SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012837314.1.32330 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012837314.1.32330
Domain Number 1 Region: 231-371
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0000000222
Family Apolipoprotein A-I 0.024
Further Details:      
 
Weak hits

Sequence:  XP_012837314.1.32330
Domain Number - Region: 44-189
Classification Level Classification E-value
Superfamily Tropomyosin 0.000981
Family Tropomyosin 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012837314.1.32330
Sequence length 440
Comment PREDICTED: uncharacterized protein LOC105957885 [Erythranthe guttata]; AA=GCF_000504015.1; RF=representative genome; TAX=4155; STAX=4155; NAME=Erythranthe guttata; cultivar=IM62; AL=Scaffold; RT=Major
Sequence
MAPLKLFVFTVLVSLILVHIGVAADDGEVKVTGSDDPDSSILEQFKSKIHTLESDIEKKT
REIKDKNEMIAAKEKLIKEKSDSIVSLESEISSLQSKGKLDAAEQIGKAHARAGELEKQV
EKLRKEIDLKLKEKDRLETRTTEAEKKASVLNSKFENLQKIIDDQKTKIRKTQRALQIAE
EELMKAKFETISKAKELMEVHGAWFPHWLVVHIANYQSLLEENWKVHGKPALETVIQKAS
EKKAQAEEWAAPHVETVKTKWVPAAKEKWIVIITNVKPQIHTLKTKTVEIYGVSKDAMTP
HIIKVQELADPYFQKLKKISKPYIDQAATAAKPHTDKLCTALKPHTDKAVHAYGIFLKSA
KVYHHKIQDRVEEKLKSHELTEALATKELVWFSASAVLALPLFFLLKICSAVFGKKTKKP
IQNGNSNNPRRKGKRVHSDK
Download sequence
Identical sequences A0A022RCI2
XP_012837314.1.32330 mgv1a006534m|PACid:17687459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]