SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012842773.1.32330 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012842773.1.32330
Domain Number 1 Region: 186-252
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.43e-22
Family DNA-binding domain from rap30 0.0022
Further Details:      
 
Domain Number 2 Region: 9-118
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 0.0000000000000016
Family Rap30/74 interaction domains 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012842773.1.32330
Sequence length 260
Comment PREDICTED: general transcription factor IIF subunit 2-like [Erythranthe guttata]; AA=GCF_000504015.1; RF=representative genome; TAX=4155; STAX=4155; NAME=Erythranthe guttata; cultivar=IM62; AL=Scaffold; RT=Major
Sequence
MADELSNNDKITLDTAKSDRSIWLMKCPPVVSKAWKSAAAESPPVAKVVVSLDPLRPEEP
SSLQFTMEMAGSEIVQMPKSFSLNMFKDFVPMTVFSETNHGSVALEGKVEHKFDMKPHHQ
NIEEYRRMCRERTNKSMVKNRQIQVLDNDRGVHMRPMPGMMGMISSTSKDKKKAAAPPIK
GPDVKRTRRDRGELEDIMFKLFEKQTNWSLKQLVQETDQPAQFLKEILNELCVYNKRGAN
QGTYELKPEYKKSAEETAAE
Download sequence
Identical sequences A0A022QZW6
XP_012842773.1.32330 mgv1a012129m|PACid:17691548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]