SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_012856487.1.32330 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012856487.1.32330
Domain Number 1 Region: 139-272
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.7e-40
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 706-782
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000461
Family PB1 domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012856487.1.32330
Sequence length 832
Comment PREDICTED: auxin response factor 2 [Erythranthe guttata]; AA=GCF_000504015.1; RF=representative genome; TAX=4155; STAX=4155; NAME=Erythranthe guttata; cultivar=IM62; AL=Scaffold; RT=Major
Sequence
MAASEVSIKGYSDANDCNSGTDKANSGAGKVDTETALYTELWRACAGPLVTVPRENELVF
YFPQGHMEQVEASTNQSADQQMPVYNLPPKILCRVVNVNLKAEPDTDEVFAQVTLMPEPN
QDENAAKKEPLPSPPPCFHVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSRQPPT
QELVAKDLHGNEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFLRGENGELRVG
VRRAMRQQGNAPSSVISSHSMHLGVLATAWHAIQTKTMFTVYYKPRTSPAEFIVSYDQYM
ESVKNNYSIGMRFKMRFEGEEAPEQRFTGTIVGTEDADSKRWPESKWRCLKVRWDETSTI
PRPERVSPWKIEPALSPPALNPLPVPRPKRPRSSVLPSSPDSSVLTREGPSKMTVDPSPA
NGFQRVLQGQELSTLRGTFAESNESEASEKPLLWNPSLDEDKIDALSASKRYMPDKWLPI
GRPESSFTDLLSGFGSQISGSRDFCMPPGDEAVSKRQRQDQQHEAKFSFIGNNNNWSIMP
SGLSLNLMDSSQGQGTTDVRYGGGFREYSLMPDSRGGDNQQRNWLMPPPISPYLQMGPAQ
PRELMPKSAFMQQQPSHDSMKPKEGNCKLFGIPLRSSSNSASLDQTLSQRTAMIERASHM
QLGLHSHQSPAIESDQSKGSKMVDSPVATSEQDKPVTKVHSGSTRSCTKVHKQGTALGRS
VDLAKFDNYDELIAELDNLFEFNGELKAKTKNWLVVYTDDEDDMMLVGDDPWDEFCGMVR
KILILTKEEVQRMSPGTFNSKGEEMSSVAEGLDAKEVKNLPATTSSSSPDNC
Download sequence
Identical sequences A0A022Q1X6
XP_012856487.1.32330 mgv1a001371m|PACid:17697052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]