SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012865238.1.60039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012865238.1.60039
Domain Number 1 Region: 254-306
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000449
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 2 Region: 196-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000128
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number 3 Region: 173-219
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000162
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 4 Region: 312-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000184
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Weak hits

Sequence:  XP_012865238.1.60039
Domain Number - Region: 16-38
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0636
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number - Region: 128-154
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0662
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012865238.1.60039
Sequence length 518
Comment PREDICTED: histone H4 transcription factor [Dipodomys ordii]; AA=GCF_000151885.1; RF=representative genome; TAX=10020; STAX=10020; NAME=Dipodomys ordii; AL=Scaffold; RT=Major
Sequence
MSPPGKGPRKENLGLQCEWGSCSFVCSAMEEFFEHVTQHLQQHMHGSREEEGEEDDSDLL
EEEFSCLWQECGFCSMDSSADLIRHVYFHCYHTKLKQWGLQALQSQADLSPCILDFQSRN
IIPDIPDHFLCLWEHCESSFDNPEWFYRHVEAHSLCCEYQAVGKDNHVVLCGWKDCTCTF
KDRCKLREHLRSHTQEKVVACPTCGGMFANNTKFLDHIRRQTSLDQQRFQCSHCSKRFAT
ERLLRDHMRNHVNHYKCPLCDMTCPLPSSLRNHMRFRHSEDRPFKCDCCDYSCKNLIDLR
KHLDTHSKESAYRCDFENCDFSARSLSSIKSHFRKVHEGDSEPRYKCHVCDKCFTRGNNL
TVHLRKKHQFKWPSGHPRFRYKEHEDGYMRLQLVRYESVELTQQLLRQPQEESDLEETLN
ESSLQGIILETVLGESGLKEETEEENGGVKGTAHSTSQDNPSPVIHMVNQTSAQGQREIV
YYVLSEAPGEPPPASEPPAESVLETLQGIPEEPELQTL
Download sequence
Identical sequences A0A1S3ELI3
ENSDORP00000001861 ENSDORP00000001861 XP_012865238.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]