SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_012867016.1.60039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012867016.1.60039
Domain Number 1 Region: 34-311
Classification Level Classification E-value
Superfamily L domain-like 3.15e-51
Family Ngr ectodomain-like 0.0087
Further Details:      
 
Domain Number 2 Region: 410-449
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000149
Family EGF-type module 0.02
Further Details:      
 
Domain Number 3 Region: 457-541
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000688
Family Fibronectin type III 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012867016.1.60039
Sequence length 677
Comment PREDICTED: vasorin [Dipodomys ordii]; AA=GCF_000151885.1; RF=representative genome; TAX=10020; STAX=10020; NAME=Dipodomys ordii; AL=Scaffold; RT=Major
Sequence
MRSRSRLPPPLLLFLLLALEPKVQGCPSGCQCNQPQTVFCTARQGSTVPRDVPPDTVGLY
IFENGITTLDPGSFASLPDLQLLDLSQNQIASLPGSIFQPLVNLSNLDLTANKLREITNE
TFRGLRRLERLYLGKNRIRHIQPGAFDALDHLLELKLQDNELRTLPPLRLPRLLLLDLSH
NSFLALEPGVLDTANVEALRLAGLGLQQLDEGLFGRLRNLHDLDVSDNQLERLPSVIRGL
RGLTRLRLAGNTRIAQLRPEDLAGLAALQELDLSNLSLQALPSDLSHLFPRLRLLAAARN
PFNCVCSLSWFGPWVRENHITLTSPEETRCHFPPKNAGRLLLELDYADFGCPATTTTATV
PTTRTEAGEPTPLPSSPVPTWLSPAAPVTEAPSLPPTALPTTMEPIPRPRDCPVSTCLNG
GTCRLGAAHHLECLCPEGVTGLYCESRVGQAVQPSPTPQATPGPPRPLPLGVEPVSPTSL
RVGLQRYLQGSTVQLRSLRLTYRNLSGPDKRLVTLRLPASLAEYTVTQLQPNATYSICVT
PLGLGRLPGGEEACGEARTPPAVRSNHAPVTQAREGNLPLLIAPALAAVLLAALAAAGAA
YCVRRGRAVAAAAQGKGQVGPGAGPLELEGVKAPLEPGPKATEDSGDALPGGPECEFPLM
GYSGPSLQGAVPAKCYI
Download sequence
Identical sequences A0A1S3ERJ0
ENSDORP00000014010 XP_012867016.1.60039 ENSDORP00000014010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]