SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012868272.1.60039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012868272.1.60039
Domain Number 1 Region: 42-207
Classification Level Classification E-value
Superfamily PR-1-like 1.31e-38
Family PR-1-like 0.00034
Further Details:      
 
Domain Number 2 Region: 310-441
Classification Level Classification E-value
Superfamily C-type lectin-like 4.9e-27
Family C-type lectin domain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012868272.1.60039
Sequence length 452
Comment PREDICTED: C-type lectin domain family 18 member A-like [Dipodomys ordii]; AA=GCF_000151885.1; RF=representative genome; TAX=10020; STAX=10020; NAME=Dipodomys ordii; AL=Scaffold; RT=Major
Sequence
MLQPEFSLGMGGQGHGPGLLTVLLGLLGINWAQGQPLQLPEQTAVIGALSRKESFLLLSL
HNRLRSRVQPPAANMQRLDWSESLAHLAQARAALCGTPAPSLASAPQRAPHVGWNMQLLP
AGSASFVEVVSLWFAEGQQYSHIATECAHNATCTHYTQLVWATSSQVGCGWHLCSAGHAV
MEAFVCAYSPGGNWELDGKTIAPYKKGAWCSLCTASLSGCFKAWDHAGGLCEVPRNPCRV
SCRNNGRLNISTCRCLCPPGYTGRYCQVRCSMQCVHGRFREEECSCICDVGYGGAQCATK
VHFPFHACDLRIDGDCFMVSSEADTYYGAKMKCQGKGGVLAQIGSQKVQDILAFYLGHLE
TTNEVTDSDFETRNFWIGLTYKMAKDSFRWATGEHQVFTSFAFGQPDNQGFGNCVELQAS
TAFNWNDQRCKTRNRYICQFAEEHISRWNPGP
Download sequence
Identical sequences A0A1S3EXV4
XP_012868272.1.60039 ENSDORP00000003835 ENSDORP00000003835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]