SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012874065.1.60039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012874065.1.60039
Domain Number 1 Region: 154-273
Classification Level Classification E-value
Superfamily DNA clamp 1.76e-17
Family DNA polymerase processivity factor 0.013
Further Details:      
 
Weak hits

Sequence:  XP_012874065.1.60039
Domain Number - Region: 36-101
Classification Level Classification E-value
Superfamily DNA clamp 0.027
Family DNA polymerase processivity factor 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012874065.1.60039
Sequence length 281
Comment PREDICTED: cell cycle checkpoint protein RAD1 isoform X2 [Dipodomys ordii]; AA=GCF_000151885.1; RF=representative genome; TAX=10020; STAX=10020; NAME=Dipodomys ordii; AL=Scaffold; RT=Major
Sequence
MPLLAQGLPDDEEQYCLVASLDNVRNLSTILKAIHFREYATCVATDNGIRVTVENAKCVQ
ANAFIQADIFREFMIKEESVTFRINFTVLLDCLSIFGSSSMPGTYTALRMCYQGYGHPLI
LFLEEGGVVTVCKINTQEPEETLDFDFSSTNVINKVILQSDGLREAFSELDMTSDVFQIT
MSPDKPYFRLSTFGNGGSSHLDYPKDSDLMEAFHCSQTQVNRYKISLLKPSTKALVLSCK
VSIRTDNRGFLSLQYMIRNEDGQICFVEYYCCPDEVSESES
Download sequence
Identical sequences A0A1S3FCS8
ENSDORP00000008804 ENSDORP00000008804 XP_012874065.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]