SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012877140.1.60039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012877140.1.60039
Domain Number 1 Region: 2-117
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.22e-36
Family Ankyrin repeat 0.000000409
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012877140.1.60039
Sequence length 118
Comment PREDICTED: myotrophin [Dipodomys ordii]; AA=GCF_000151885.1; RF=representative genome; TAX=10020; STAX=10020; NAME=Dipodomys ordii; AL=Scaffold; RT=Major
Sequence
MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGAD
INAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKSVKGPDGLTALEATDNQAIKALLQ
Download sequence
Identical sequences A0A1S3FLD7 A0A250Y9A2
ENSDORP00000012009 ENSDORP00000012009 XP_007951981.1.48129 XP_012877140.1.60039 XP_020031857.1.5219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]