SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012881649.1.60039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012881649.1.60039
Domain Number 1 Region: 216-393
Classification Level Classification E-value
Superfamily MIR domain 3.53e-47
Family MIR domain 0.0023
Further Details:      
 
Domain Number 2 Region: 659-810
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000438
Family SPRY domain 0.053
Further Details:      
 
Domain Number 3 Region: 102-186
Classification Level Classification E-value
Superfamily MIR domain 0.00000719
Family MIR domain 0.028
Further Details:      
 
Domain Number 4 Region: 3837-3915
Classification Level Classification E-value
Superfamily EF-hand 0.0000101
Family Calmodulin-like 0.041
Further Details:      
 
Domain Number 5 Region: 1979-2049
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000112
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 
Domain Number 6 Region: 440-551
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000116
Family IP3 receptor type 1 binding core, domain 2 0.013
Further Details:      
 
Domain Number 7 Region: 1302-1426
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000274
Family SPRY domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012881649.1.60039
Sequence length 4821
Comment PREDICTED: ryanodine receptor 1 [Dipodomys ordii]; AA=GCF_000151885.1; RF=representative genome; TAX=10020; STAX=10020; NAME=Dipodomys ordii; AL=Scaffold; RT=Major
Sequence
MGDGGEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPP
DLAICCFILEQSLSVRALQEMLANTVEAGVESSQGGGHRTLLYGHAILLRHAHSRMYLSC
LTTSRSLTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDLILVSVSSERYL
HLSTASGELQVDASFMQTLWNMNPICSCCEEGYVTGGHVLRLFHGHMDECLTISPSDSDD
QRRLVYYEGGSVCTHARSLWRLEPLRISWSGSHLRWGQPLRIRHVTTGRYLALTEDQGLV
VVDASKAHTKATSFCFRISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYA
APDTKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIYSTAGLYNQFIKGLDS
FSGKPRGSGPPVGSALPIEGVILSLQDLIGYFEPPSEELQHEEKQSKLRSLRNRQSLFQE
EGMLSLVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRTNCALF
STNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVL
DVLCSLCVCNGVAVRSNQDLITENLLPGRELLLQTDLINYVTSIRPNIFVGRAEGSTQYG
KWYFEVMVDEVVPFLTAQATHLRVGWALTEGYSPYPGGGEGWGGNGVGDDLYSYGFDGLH
LWTGHVARPVTSPGQHLLAPEDVVSCCLDLSVPSISFRINGCPVQGVFEAFNLDGLFFPV
VSFSAGVKVRFLLGGRHGEFKFLPPPGYAPCHEAVLPRERLHLEPIKEYRREGPRGPHLV
GPSRCLSHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGQVRDDN
KRLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYM
MSNGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVAQGWSYSAVQDIPARRNPR
LVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQAENQSRGDRTRIFRAEKS
YVVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADELAYVFNGHRVSRMDGTVDTPP
CLRLTHRTWGSQNSLVEMLFLRLSLPVQFYQHFRCTAGATPLAPPGLQPPAEDEARAAEP
DPDYENLRRSAGGWGEAEAGKEGTAKDGGTPQPGMEAQPVRAENEKDATTEKNKKRGFLF
KAKKAAMMTQPPATPVLPRLPREVVPTDNRDDPEIILNTTTYYYSVRVFAGQEPSCVWVG
WVTPDYHQHDMTFDLTKVRAVTVTMGDEQGNVHSSLKCSNCYMVWGGDFVSPGQQGRISH
TDLVIGCLVDLATGLMTFTANGKESNTFFQVEPNTKLFPAVFVLPTHQNVIQFELGKLKN
IMPLSAAMFLSERKNPAPQCPPRLEVQMLMPVSWSRMPNHFLQVDTRRAGERLGWAVQCQ
EPLTMMALHIPEENRCMDILELSERLDLQRFHSHTLSLYRAVCALGNNRVAHALCSHVDQ
AQLLHTLEDAHLPGPLRAGYYDLLISIHLESACRSRRSMLSEYIVPLTPETRSITLFPPG
RSAEDGPRRHGLPGVGVTTSLRPPHHFSPPCFVAALPAAGGTEAPARLSPAIPLEALRDK
ALRMLGEAVRDGGQHARDPIGGSVEFQFVPVLKLVSTLLVMGVFSDEDVKQILKMIEPEV
FTEIEEEEEEAEEEEEEDEEEKEEDEEEEAQEKEDEEKEEEEAAEGEKEEGLEEGLLQMK
LPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDKLQGNQRGRYGLLMKAFTMSAAE
TARRTREFRSPPQEQSLQELVSHMVVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRA
LPRAYTISPSSVADTMSLLECLGQIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNL
MRALGMHETVMEVMVNVLGGGESKEIRFPKMVTSCCRFLCYFCRISRQNQRSMFDHLSYL
LENSGIGLGMQGSTPLDVAAASVIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLLAKG
YPDIGWNPCGGERYLDFLRFAVFVNGESVEENANVVVRLLIRKPECFGPALRGEGGSGLL
AAIEEAIRISEDPARDGPGVRRDRRPHFGEEPPEENRVHLGHAIMSFYAALIDLLGRCAP
EMHLIQAGKGEALRIRAILRSLVPLDDLVGIISLPLQMPTLGKDGALVQPKMSASFVPDH
KASIVLFLDRVYGIDNQDFLLHVLDVGFLPDMRAAASLDTATFSTTEMALALNRYLCLAV
LPLITKCAPLFAGTEHRAIMVDSMLHTVYRLSRGRSLTKAQRDVIEDCLMALCRYIRPSM
LQHLLRRLVFDVPILNEFAKMPLKLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKL
FWGIFDSLAHKKYDQELYRIAMPCLCAIAGALPPDYVDASFSSKTEKKATVDAEGNFDPR
PVETLNVIIPEKLDSFINKFAEYSHEKWAFDKIQNSWSYGENIDEEQKTHPMLRPYKTFS
EKDKEIYRWPIKESLKAMIAWEWTIEKAREGEEEKTEKKKTRKISQTAQTYDPREGYSPQ
PPDLSGVTLSRELQAMAEQLAENYHNTWGRKKKQELEAKGGGTHPLLVPYDTLTAKEKAR
DREKAQELLKFLQMNGYAVTRGLKDMELDTSSIEKRFAFGFLQQLLRWMDISQEFIAHLE
AVVSSGRVEKSPHEQEIKFFAKILLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEM
ITSLFCKLAALVRHRVSLFGTDAPAVVNCLHILARSLDARTVMKSGPEIVKAGLRSFFES
ASEDIEKMVENLRLGKVSQARTQVKGVGQNLTYTTVALLPVLTTLFQHIAQHQFGDDVIL
DDVQVSCYRTLCSIYSLGTTRNPYVEKLRPALGECLARLAAAMPVAFLEPQLNEYNACSV
YTTKSPRERAILGLPNSVEEMCPDIPVLERLMADIGGLAESGARYTEMPHVIEITLPMLC
SYLPRWWERGPEAPPPALPAGAPPPCTEVTSDHLNSLLGNILRIIVNNLGIDEASWMKRL
AVFAQPIVSRARPELLRSHFIPTIGRLRKRAGKVVAEEEQLRLEAKAEAEEGELLVRDEF
SVLCRDLYALYPLLIRYVDNNRAHWLTEPNPNAEELFRMVGEIFIYWSKSHNFKREEQNF
VVQNEINNMSFLTADNKSKMAKAGDVQSGGSDQERTKKKRRGDRYSVQTSLIVATLKKML
PIGLNMCAPTDQDLIGLAKARYALKDTDEEVREFLQNNLNLQGKVEGSPSLRWQMALYRG
LPGREEDADDPEKIVRRVQEVSAVLYHLEQTEHPYKSKKAVWHKLLSKQRRRAVVACFRM
TPLYNLPTHRACNMFLESYKASWILTEDHSFEDRMIDDLSKAGEQEEEEEEVEEKKPDPL
HQLVLHFSRTALTEKSKLDEDYLYMAYADIMAKSCHMEEGGENGEAEGEEEAEVSFEEKE
MEKQRLLYQQSRLHNRGAAEMVLQMISACKGETGAMVSSTLKLGISILNGGNAEVQQKML
DYLKDKKEVGFFQSIQALMQTCSVLDLNAFERQNKAEGLGMVNEDGTVINRQNGEKVMAD
DEFTQDLFRFLQLLCEGHNNDFQNYLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYY
SGKDVIEEQGKRNFSKAMSVAKQVFNSLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFA
HMMMKLAQDSSQIELLKELLDLQKDMVVMLLSLLEGNVVNGMIARQMVDMLVESSSNVEM
ILKFFDMFLKLKDIVGSEAFQDYVTDPRGLISKKDFQKAMDSQKQFTGPEIQFLLSCSEA
DENEMINCEEFANRFQEPARDIGFNVAVLLTNLSEHVPHDPRLRTFLELAESILEYFRPY
LGRIEIMGASRRIERIYFEISETNRAQWEMPQVKESKRQFIFDVVNEGGESEKMELFVSF
CEDTIFEMQIAAQISEPEGEPEESEDEGATEAGTEVPEEGSAGPEGTTGAVAAGVTARLA
AAMSRALRGLSYRSLRRRVRKLRRLTAREAATAVVALLWAVVTQAGSAGAGAAAGTLRLL
WGSLFGGGLVDSAKKVTVTELLAGMPDPTGDEVHGQQPTGPGGDADGEGEGEGEGDTQEG
AGEEEAASDEARQGGADRAVAVADGSPFRPEGAGGLGDMGDTTPVEPPTPEGSPILKRKP
GVEGEEEEEQPPEPEPEPEPEKADTENGEKEEVQEPPPEEPPTKTAPPPPPPKKEEAGGA
GLEFWGELEVQRVKFLNYLSRNFYTLRFLALFLAFAINFILLFYKVSDSPPGEDDMEGSA
AGEMSGAGSGGGSGWGSGAGEEVEGDEDENMVYYFLEESTGYMEPALRCLSLLHTLVAFL
CIIGYNCLKVPLVIFKREKELARKLEFDGLYITEQPEDDDVKGQWDRLVLNTPSFPSNYW
DKFVKRKVLDKHGDIFGRERIAELLGMDLASLEITAHSGRKPEPPPGLLTWLMSIDVKYQ
IWKFGVIFTDNSFLYLGWYMVMSLLGHYNNFFFAAHLLDIAMGVKTLRTILSSVTHNGKQ
LVMTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGG
IGDEIEDPAGDEYELYRVVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMET
KCFICGIGSDYFDTTPHGFETHTLEEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQE
RCWDFFPAGDCFRKQYEDQLS
Download sequence
Identical sequences A0A1S3G026
XP_012881649.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]