SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012882653.1.60039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012882653.1.60039
Domain Number 1 Region: 13-126
Classification Level Classification E-value
Superfamily POZ domain 2.43e-26
Family BTB/POZ domain 0.00062
Further Details:      
 
Domain Number 2 Region: 314-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.98e-20
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 3 Region: 355-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.68e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 278-327
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000167
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012882653.1.60039
Sequence length 449
Comment PREDICTED: zinc finger and BTB domain-containing protein 14 [Dipodomys ordii]; AA=GCF_000151885.1; RF=representative genome; TAX=10020; STAX=10020; NAME=Dipodomys ordii; AL=Scaffold; RT=Major
Sequence
MEFFISMSETIKYNDDDHKTLFLKTLNEQRLEGEFCDIAIVVEDVKFRAHRCVLAACSTY
FKKLFKKLEVDSSSVIEIDFLRSDIFEEVLNYMYTAKISVKKEDVNLMMSSGQILGIRFL
DKLCSQKRDVSSPDENNGQSKSKYCLKINRPIGDAADTQDDDVEEIGDQDDSPSDDTVEG
TPPSQEDGKSPTTTLRVQEAILKELGSEEVRKVNCYGQEVESMETPESKDLGSQTPQALT
FNDGMSEVKDEQTPGWTTAASDMKFEYLLYGHHREQIACQACGKTFSDEGRLRKHEKLHT
ADRPFVCEMCTKGFTTQAHLKEHLKIHTGYKPYSCEVCGKSFIRAPDLKKHERVHSNERP
FACHMCDKAFKHKSHLKDHERRHRGEKPFVCGSCTKAFAKASDLKRHENNMHSERKQVTP
SALQSETEQLQAAAMAAEAEQQLETIACS
Download sequence
Identical sequences A0A1S3G1G8
ENSDORP00000014300 ENSDORP00000014300 XP_012882653.1.60039 XP_012882654.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]