SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012886179.1.60039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012886179.1.60039
Domain Number 1 Region: 2128-2221
Classification Level Classification E-value
Superfamily C-type lectin-like 1.65e-30
Family Link domain 0.00012
Further Details:      
 
Domain Number 2 Region: 509-648
Classification Level Classification E-value
Superfamily FAS1 domain 3.92e-30
Family FAS1 domain 0.0018
Further Details:      
 
Domain Number 3 Region: 1392-1440,1518-1632
Classification Level Classification E-value
Superfamily FAS1 domain 2.35e-26
Family FAS1 domain 0.0023
Further Details:      
 
Domain Number 4 Region: 1632-1787
Classification Level Classification E-value
Superfamily FAS1 domain 2.09e-25
Family FAS1 domain 0.0052
Further Details:      
 
Domain Number 5 Region: 884-1041
Classification Level Classification E-value
Superfamily FAS1 domain 4.19e-23
Family FAS1 domain 0.0044
Further Details:      
 
Domain Number 6 Region: 387-499
Classification Level Classification E-value
Superfamily FAS1 domain 2.49e-19
Family FAS1 domain 0.0056
Further Details:      
 
Domain Number 7 Region: 2219-2381
Classification Level Classification E-value
Superfamily FAS1 domain 4.32e-19
Family FAS1 domain 0.0083
Further Details:      
 
Domain Number 8 Region: 1049-1166
Classification Level Classification E-value
Superfamily FAS1 domain 0.0000000366
Family FAS1 domain 0.0067
Further Details:      
 
Domain Number 9 Region: 1463-1501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000467
Family Merozoite surface protein 1 (MSP-1) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012886179.1.60039
Sequence length 2492
Comment PREDICTED: stabilin-1 [Dipodomys ordii]; AA=GCF_000151885.1; RF=representative genome; TAX=10020; STAX=10020; NAME=Dipodomys ordii; AL=Scaffold; RT=Major
Sequence
MAGAQSLLPLCLLAFCLVGSSVIRGQKVRSKRCDVKTKFVTHTPCTTCAAIKKVVCPLGW
LRHFPEKITKDCQYEVQLGASLVSLSGCSLECSKDVVQKACCPGYWGSLCYECPGGAETP
CNGHGTCLDGISGNGTCVCQENFSGSACQECQDPQRFGPDCQSVCSCVHGVCSHGPQGDG
SCLCFAGYTGPRCDQELRVCKERSCPQNSQCSAEAPGCRCLPGHTLQDSKCIAPNPCQSS
PCSPLASCSVSPTGQAQCHCPENYHGDGKICLPHDPCTNNFGGCPSNSTVCIYQKPGTAV
CSCQPGLFRFNSNTSAGCFAYCSRHSCDQSATCQVTPNGKTRCVCKEGEVGDGRACYGHL
LHEVQKAHQIGLVFLKLRVAISMFEQGCQDILTTSGPFTVLVPSISSSTGSSKTMNAALA
QQLCRQHIIAGQHILEDTKSPSIRRWWTLAGQEITVTFNRIRYTYTYKDQPQQTFIIQKT
NYIAANGIFHVVTALQWQVSPKLPGDPKKTVGQILASTEDFSRFETILENCGLPSILEGP
GPFTVFAPSNEAVDSLRDGRLIYLFTGGLSKLQELVKYHIYSHGQLTVEKLISKGRVLTM
ANQILAVNISEEGRILLGPNGIPLRRVDVPAANGVIHMLEGILLPPTILPILPKHCDEEQ
HKIVMCSDGIQGHGACLCFPDYKGIACHICSNPNKHGDQCQEDCGCVHGLCDNRPGSGGV
CQHGTCAPGFRGRFCNESLGGCGTTGVAQLCHLHARCLSLEGVPRCVCLDGFEGDGYSCT
RSNPCAHPDRGGCSENAECVPGDLGSHHCTCHKGWSGDGRVCVAIDECGLDTRGGCHADA
LCSYVGPGQSRCTCKLGFAGDGYECSPIDPCRVGNGGCHGLATCQAVGGGQRICTCPPRF
GGDGFSCYGDIFRELEANAHFSAFFQWFKSTGITLPADSNVTALVPSESAIRRLSPKDRA
FWLQPKMLPTLIRAHFLQGAFSEEDLAQMSGQKVATLSSTTRWEIHNISGRVWVQNASVD
VADLLATNGVLHIISQVLLPPQGDVLARKGLLQQLDLVPAFHLFRDLLQRHKLVSQIEAA
AAYTIFIPTNHSLEAQGNSSSLDADTVRHHVILGEALSVETLSKGGHRNSLLGTAHWLVF
YNHSSQPEVNHVPMEGPLLEAPGQSLFGLSGILTVGSSRCLHSHAEALREKCINCTRKFR
CTQGFQLQDTPRKSCVYRSGFSFSRGCSYTCAKKIQVPDCCPGFFGMLCEPCPGGLGGVC
SGHGQCQDRLLGSGECRCQEGFHGTACEMCELGRYGPTCAGVCDCVHGLCQEGLRGDGSC
VCNVGWQGLRCDQKITAPQCPKTCDSNANCVQVSDGAVVCVCAAGYTGNGSYCSEVDPCA
HDHGGCSPHANCTKVAPGQRICTCQDGYSGDGELCQETNSCLVHHGGCHIHAECIPTGPQ
QVSCSCREGYSGDGIQACELLNPCSQNNGGCSPYAVCKSSGDGQRTCTCDTAHTVGDGFT
CRTRVGLELLRDKQALFFSLHLLEYEDLKGDGPFTIFVPHADLMTNLSKDDLAQIRAHRQ
LVFRYHVVGCRQLSSQELLDQGYATALSGHTLRFSEREGSIYLNDFARVVSSDHEAVNGV
LHFIDRVLLPPDVLHWEADATPTPRRNVTVAAESFGYKIFSRLVTVAGLLPMLRDVSHRP
LTMLWPTDSALQALPPDRQAWLYHEDHRDKLAAILRGHIIRNVEALASDLPNLGPLRTMH
GTPISFSCSRARPGELMVGEDDAHIVQRHLPFEGGLAYGIDQLLEPPGLGSRCDHFATQS
LQMKTCSICGLELPCPVGSWEQGTPEACWRHYSRFWTTPLLSSLALRSAWVRPSPWGQTP
RLSRGCYRNCVTTVWKPRCCPGHYGSECQACPGGPSSPCSSHGVCMDGMSGSGQCVCHSG
FAGIACELCAPGAFGPQCQACRCGPHGHCDEGLGGSGSCWCDEGWTGSRCEVQLELQPVC
VPPCAPQAVCRGNNSCECSLGYEGDGRVCTVVDLCQHGHGGCSEHANCSQVGTVVACVCL
SDYEGDGWSCRARNPCLDGHRGGCSEHADCLNTGPNTRRCECHAGYVGDGLLCLEEPEPP
VDRCLGHPSPCHADAVCTDLHFQEKKAGVFHLQASSGPYGLTFSEAEVACGAQGAVLASL
SQLSAAQQLGFHLCLVGWLANASAAHPVVFPAADCGDGRVGVVSMGVRKNLSEHWDAYCY
RVQDVTCRCQVGFVGDGISVCNGKLLDVLAATANFSTFYGMLLGYANTTQRGLDFLDFLN
DELTYKTLFVPVNEGFAHNMTLTGPDLELHASNATFLSANASQGTLLPAHSGLSLFINDM
GSDNSSWAPATPGAVVVSHVIFWDIMAFNGIIHVLASPLLAPLQPEAVLAPEAPSVAAGV
GAVVAAGTLLGLVAGAFYLRTRGKPTGFSFSAFQAEDDADEDFSPWQEGPTSPTLVSVPN
PIFGSHDAFCEPFDDSLLEDDFPDTQRILAVK
Download sequence
Identical sequences A0A1S3GD69
XP_012886179.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]