SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012887427.1.60039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012887427.1.60039
Domain Number 1 Region: 21-181
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.97e-45
Family Dual specificity phosphatase-like 0.0000000855
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012887427.1.60039
Sequence length 185
Comment PREDICTED: dual specificity protein phosphatase 3 [Dipodomys ordii]; AA=GCF_000151885.1; RF=representative genome; TAX=10020; STAX=10020; NAME=Dipodomys ordii; AL=Scaffold; RT=Major
Sequence
MSGPFDLSVQDLNDLLSDGTGCYSLPSQPCNEVTPRIYVGNATVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAHKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVRSAVSIVRQNREIGPNDGFLAQLCHLNGRLIRE
GKLKL
Download sequence
Identical sequences A0A1S3GHE1
XP_012887427.1.60039 ENSDORP00000014212 ENSDORP00000014212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]