SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012887633.1.60039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012887633.1.60039
Domain Number 1 Region: 1-138
Classification Level Classification E-value
Superfamily SNARE-like 5.4e-50
Family Sedlin (SEDL) 0.0000000879
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012887633.1.60039
Sequence length 140
Comment PREDICTED: trafficking protein particle complex subunit 2 [Dipodomys ordii]; AA=GCF_000151885.1; RF=representative genome; TAX=10020; STAX=10020; NAME=Dipodomys ordii; AL=Scaffold; RT=Major
Sequence
MSGSFYFVIVGHHDNPVFEMEFLPAGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMY
LKTVDKFNEWFVSAFVTAGHMRFIMLHDVRQEDGIKNFFTDVYDLYIKFAMNPFYEPNSP
IRSSAFDRKVQFLGKKHLLS
Download sequence
Identical sequences A0A1S3GFZ9 F1SRI0 Q3T0F2 W5PP20
ENSBTAP00000014509 9913.ENSBTAP00000014509 ENSBTAP00000014509 ENSSSCP00000028340 ENSSSCP00000028837 ENSOARP00000012196 NP_001029968.1.59421 NP_001029968.1.76553 NP_001231738.1.46622 XP_004710020.1.18182 XP_005409257.1.28644 XP_005701161.1.57651 XP_005889639.1.15283 XP_006042953.1.26621 XP_006212688.1.17985 XP_006892439.1.29581 XP_007951011.1.48129 XP_010964534.1.22495 XP_011961622.1.66739 XP_012022520.1.54773 XP_012887633.1.60039 XP_012887634.1.60039 XP_012887635.1.60039 XP_019811654.1.53367 XP_020750598.1.74333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]