SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012887773.1.60039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012887773.1.60039
Domain Number 1 Region: 232-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.69e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 344-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.5e-19
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 3 Region: 288-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.34e-19
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 4 Region: 456-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 176-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-17
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 6 Region: 2-53
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-17
Family KRAB domain (Kruppel-associated box) 0.00087
Further Details:      
 
Domain Number 7 Region: 400-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-16
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 8 Region: 512-569
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.78e-16
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 9 Region: 554-606
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000101
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 10 Region: 624-673
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000064
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 11 Region: 82-134
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000012
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 12 Region: 121-177
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000349
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012887773.1.60039
Sequence length 674
Comment PREDICTED: zinc finger protein 791-like [Dipodomys ordii]; AA=GCF_000151885.1; RF=representative genome; TAX=10020; STAX=10020; NAME=Dipodomys ordii; AL=Scaffold; RT=Major
Sequence
MESFSFKDVSVKFTKEEWALLNPSQKTFYRDVMLETFSNFNCIGHKWTDLNMNDQHKNCQ
RNIRHVISHSGYKYEHKECRQKVYKYKKCGKAFISHKSVQQHMASHNVNGPCECKVCLKI
FDTSSSFQVHQQTHQAKSLYKCQQNEKSFVCYSSGQLHENNQSVKKSYECKQCGKTFKQL
GYLRIHEKTHAEENPYQCKQCGKFLSCPSALKVHEETHSVGKPYACKQCGKAFRQASYFR
EHERTHSAKNPYECKQCGKSLSSSSYLRVHERIHTEEKLYACKQCGKTFKHLSSVRMHEK
THSEENPYECKQCGKSLSSPSALKVHEETHTEGKPYACKQCGKAFRRARYFREHERTHSA
KNPYECKQCGKSLSSSSYLRVHERIHTGEKLYACKQCGKTFKQLKYIRIHEKTHMEENPY
ECKQCGKSLSSPNALKVHEETHSVGKPYACKQCGKAFRRASYFREHERTHSARNPFECKH
CGKSLSCSSYLRVHERIHTGENLYACKQCGKAFLCHSSLQIHEGVHSGIQAYECKYCGKS
FRSLRYFRIHEGIHSGEKCYECKECGKNFSCAASLKVHRTIHTGEKPHECKQCGESFQYL
RCLRVHEHAHAKICSYRCKRCGKTYKYLSCLRAHERTHTERNPCKCKYCGKTLSCSSYLR
IHERTHTGEMYKCK
Download sequence
Identical sequences A0A1S3GFX9
XP_012887773.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]