SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012901270.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012901270.1.14098
Domain Number 1 Region: 38-143
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.65e-16
Family Growth factor receptor domain 0.0019
Further Details:      
 
Domain Number 2 Region: 147-200
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000157
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012901270.1.14098
Sequence length 263
Comment PREDICTED: R-spondin-1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MRLGLCVVVLVLSWMHLAAGSRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKL
FILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKESLYL
HKGRCYPACPEGSAAANGTMECSSPAQCEMSEWSPWGPCSKKKRLCGFRRGSEERTRRVL
HAPGGDHTICSDTKETRRCTVRRTPCPEGQKRRKGGQGRRENANRNPSRKESKEAGAGSR
RRKGHQQPQHQGTVGPVTPAGPT
Download sequence
Identical sequences G9KM10
XP_004740812.1.14098 XP_012901270.1.14098 ENSMPUP00000014597 ENSMPUP00000014597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]