SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012902799.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012902799.1.14098
Domain Number 1 Region: 70-166
Classification Level Classification E-value
Superfamily S13-like H2TH domain 3.01e-23
Family Middle domain of MutM-like DNA repair proteins 0.013
Further Details:      
 
Domain Number 2 Region: 230-256
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000647
Family Ran binding protein zinc finger-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012902799.1.14098
Sequence length 517
Comment PREDICTED: endonuclease 8-like 3 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MYFGPKALRIHFGMKGSIMINPLEHKNKNGVSPVFELQLTKDLICFFDSSVEFRNSTESQ
QRVRMMEELDVCSPKFSFSRAESEVKKQKGRMLCDVLMDQKVLPGVGNIIRNEALFDSGL
HPAVKVCQLTDEQTHYLVKMIRDFSILFYRCHKTGSVISKHYKVYKRPHCCQCCCKITVC
RLGENNRMTYFCPRCQKENPQHVDICKLPTRNTTIRWPCSRGEHVARKWEEQWACVVCTL
INSPSSKTCAACLTSRPPDSVIENEEHSIAFTDLVRYPCNSFGKPSKEVKINRKTAFGTT
TLVLADFSNKSSALERKTSQNQTLDGEFQNRSPTHVCFNDPLHRSEDRANHGSQPSDKAN
VSPSLCPQSELFSPAYKKLKTTHSSSPDLRSGKPGFPASELGIKLTDGTWALHADRPRCS
KHSRRCVLRVVRKDGENKNRQFYACPLPREEQCGFFQWADLSFPFCNHGKRSIMRTVLKI
GPNNGKNFFVCPLGKAKQCNFFQWAENGPGVKFIPGC
Download sequence
Identical sequences M3YL40
ENSMPUP00000012047 ENSMPUP00000012047 XP_012902799.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]