SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012903282.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_012903282.1.14098
Domain Number - Region: 65-138
Classification Level Classification E-value
Superfamily LemA-like 0.0523
Family LemA-like 0.011
Further Details:      
 
Domain Number - Region: 155-257
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0931
Family Arfaptin, Rac-binding fragment 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012903282.1.14098
Sequence length 370
Comment PREDICTED: single-pass membrane and coiled-coil domain-containing protein 2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MALMKLSDRTSLQMMTVGKEQQLTEKNSGFLQNMDAAQGAKQNLLRGFTKMDHILDRSDD
KDNTFSEKPQTAFLHETETTKWNMAELEAEHHRDQQNEWEEQETSQVQHEDPDMSTSLQF
SKENIPELTRENTFFQLNYWNSQMGLQVKELGADHIGWMEKINNIIRKINLTEDTMKRLL
NEVISLEGQIEKLESHQDLGADQGANIEEKIMEIKKQIEEMDNNYVQEDACNEAHELKEK
LIARMKNFYKDMTLISTKLGVYQMQEGKTDSQSPEEMVMEESERLLPQAPPPPSVQNSPA
RVTVWKRALRIFIMFYVLIFTGLSCYILFFDATFIFESLLPTMLGRRRMWELREIIAPFL
NLEVEDLLPS
Download sequence
Identical sequences M3YGI4
ENSMPUP00000010441 ENSMPUP00000010441 XP_012903282.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]