SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012903326.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012903326.1.14098
Domain Number 1 Region: 90-395
Classification Level Classification E-value
Superfamily L domain-like 2.15e-57
Family Leucine rich effector protein YopM 0.072
Further Details:      
 
Domain Number 2 Region: 489-629
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 2.03e-36
Family Gelsolin-like 0.00027
Further Details:      
 
Domain Number 3 Region: 609-720
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 6.87e-26
Family Gelsolin-like 0.00055
Further Details:      
 
Domain Number 4 Region: 1158-1269
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 2.13e-25
Family Gelsolin-like 0.0009
Further Details:      
 
Domain Number 5 Region: 899-943,981-1066
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.03e-23
Family Gelsolin-like 0.013
Further Details:      
 
Domain Number 6 Region: 749-857
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.02e-19
Family C-terminal, gelsolin-like domain of Sec23/24 0.01
Further Details:      
 
Domain Number 7 Region: 7-119
Classification Level Classification E-value
Superfamily L domain-like 7.23e-19
Family Internalin LRR domain 0.076
Further Details:      
 
Domain Number 8 Region: 1053-1148
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 0.0000000000000201
Family Gelsolin-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012903326.1.14098
Sequence length 1273
Comment PREDICTED: protein flightless-1 homolog isoform X2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MEATGVLPFVRGVDLSGNDFKGGYFPENVKAMTSLRWLKLNRTGLCYLPEELAALQKLEH
LSVSHNNLTTLHGELSSLPSLRAIVARANSLKNSGVPDDIFKLDDLSVLDLSYNQLTECP
RELENAKNMLVLNLSHNSIDTIPNQLFINLTDLLYLDLSENRLESLPPQMRRLVHLQTLV
LNGNPLLHAQLRQLPALTALQTLHLRNTQRTQSNLPTSLEGLSNLADVDLSCNDLTRVPE
CLYTLPSLRRLNLSSNQITELSLCIDQWVHLETLNLSRNQLTSLPSAICKLTKLKKLYLN
SNKLDFDGLPSGIGKLTSLEEFMAANNNLELIPESLCRCTKLRKLVLNKNRLVTLPEAIH
FLTEIEVLDVRENPSLVMPPKPADRAAEWYNIDFSLQNQLRLAGASPATVAAAAAAGSGP
KDPLARKMRLRRRKDSAQDDQAKQVLKGMSDVAQEKNKKQEESIDARAPGGKARRWDQGL
EKPRLDYSEFFTEDVGQLPGLTIWQIENFVPVLVEEAFHGKFYEADCYIVLKTFLDDSGS
LNWEIYYWIGGEATLDKKACSAIHAVNLRNYLGAECRTVREEMGEESEEFLQVFDNDISY
IEGGTASGFYTVEDTHYITRMYRVYGKKNIKLEPVPLKGSSLDPRFVFLLDQGLDIYVWR
GTQATLSSTTKARLFAEKINKNERKGKAEITLLVQGQEPPEFWEVLGGEPSEIKKHVPDD
FWPPQPKLYKVGLGLGYLELPQINYKLSVEHKTRPKVELLPKMRLLQSLLDTRCVYILDC
WSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHATVSRSLEGTEAQVFKAKFKNWDD
VLTVDYTRNAESVLQGPGLTGKVKRDAEKKDQMKADLTALFLPRQPPMALAEAEQLMEEW
NEDLDGMEGFVLEGKKFARLPEEEFGHFYTQDCYVFLCRYWVPVEYEEEEEKKEEKEEEK
AGAEGKEGEEAAAEAEEKQPEEDFQCIVYFWQGREASNMGWLTFTFSLQKKFESLFPGKL
EVVRMTQQQENPKFLSHFKRKFIIHRGKRKVAQAAQQPSLYQIRTNGSALCTRCIQINTD
SSLLNSEFCFILKVPFESEDNQGIVYAWVGRASDPDEAKLAEDILNTMFDASYSKQVINE
GEEPENFFWVGIGAQKPYDDDAEYMKHTRLFRCSNEKGYFAVTEKCSDFCQDDLADDDIM
LLDNGQEVYMWVGTQTSQVEIKLSLKACQVYIQHMRSKEHEQPRRLRLVRKGNEQHAFTR
CFHAWSTFRKPLA
Download sequence
Identical sequences M3XLT4
XP_004776582.1.14098 XP_012903326.1.14098 ENSMPUP00000000034 ENSMPUP00000000034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]