SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012903564.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012903564.1.14098
Domain Number 1 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-23
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 2 Region: 377-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.97e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 9-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.84e-22
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 4 Region: 265-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.56e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 419-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.91e-21
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 209-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000304
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 111-185
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000499
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012903564.1.14098
Sequence length 477
Comment PREDICTED: zinc finger protein 211-like [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MAAAVPADPAQGSVTFEDVVVYFSWEEWGLLDETQRCLYHDVMLENFALVISLGCWYGME
EEEALSVQQVSMGRTSSPAPSVWRAQPCDKCVLLGRDILYLGEDQGAHHGQNYICEACGK
LWLDVNLQPQKHNEEKPFRWDMELVTRYKLHVSGKPFPCGGVGKDFLAIVSLLRHQATLK
GAEPHSSFEHRDSFQGRKSPPEYSNHGKSFSYDCKLFQHQQLHPRESYHDWDNCEKPFNQ
SSVLSDCPRAYPETRSYECNECGKSFSQSYNLIQHHRIHTGARPYKCSECGKAFSFKFRL
VQHLQIHTRVRPYACGECGKAFSYSSTLIKHQRVHTREKPYKCGECGNSFSQSSNLIQHQ
KIHSGARPYKCNECAKSFSYKCKLVQHLRIHTGERPYECGECGKSFSHRSTLNQHQRIHT
GARPYKCGECEKSFSQKSNLIQHRRVHTGEKPYECGECGKSFSQSSHIIQHRKLHTR
Download sequence
Identical sequences M3Y4B8
XP_004776943.1.14098 XP_004776945.1.14098 XP_012903561.1.14098 XP_012903562.1.14098 XP_012903563.1.14098 XP_012903564.1.14098 ENSMPUP00000006169 ENSMPUP00000006169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]