SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012904275.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012904275.1.14098
Domain Number 1 Region: 236-282
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.77e-17
Family TRASH domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012904275.1.14098
Sequence length 1295
Comment PREDICTED: zinc finger MYM-type protein 2 isoform X2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MDTGSVGGLELTDQTPVLLGSTAMATSLTNVGNSFSGPPNPLVARSNKFQNSSVEDDDDV
VFIEPVQPPPPSAPVVTDQRTVTFSSSKNEELQGNDSKILPSSKELASQKGSVSETIVID
DEEDMETNQGQEKNSSNFIERRPPETKNRTNDVDFPTSSFSRSKTKTGVGPFNPGRMNVA
GDVFQNGESATHHNPDSWISQSASFPRNQKQPGVDSLSPVASLPKQIFQPSAQQQQQQQQ
PTKPVKVTCANCKKPLQKGQTAYQRKGSAHLFCSTTCLSSFSHKPAPKKLCVMCKKDITT
MKGTIVAQVDSSESFQEFCSTSCLSLYEDKQNPTKGALNKSRCTICGKLTEIRHEVSFKN
MTHKLCSDHCFNRYRMANGLIMNCCEQCGEYLPSKGAGNNVLVIDGQQKRFCCQSCVSEY
KQVGSHPSFLKEVRDHMQDSFLMQPEKYGKLTTCTGCRTQCRFFDMTQCIGPNGYMEPYC
STACMNSHKTKYAKSQSLGIICHFCKRNSLPQYQATMPDGKLYNFCNSSCVAKFQALSMQ
SSSNGQFVAPSDIQLKCNYCKNSFCSKPEILEWENKVHQFCSKTCSDDYKKLHCIVTYCE
YCQEEKTLHETVNFSGVKRPFCSEGCKLLYKQDFARRLGLRCVTCNYCSQLCKKGATKEL
DGVVRDFCSEDCCKKFQDWYYKAARCDCCKSQGTLKERVQWRGEMKHFCDQHCLLRFYCQ
QNEPNMTTQKGPENLHYDQGCQTSRTKMTGSAPPPSPTPNKEMKNKAVLCKPLTMTKATY
CKPHMQTKSCQTDDNWKTEYVPVPIPVPVYIPVPMHMYSQNIPVPTTVPVPVPVPVFLPA
SLGSSEKIPAVAEELKSKVSSDPLDTELLTMTDMMTEDEGKTEAANINSVIIETDIIGSD
LLKNSDPETQSNMPDVPYEPDLDIEIDFPRAAEELDMENEFLLPPVFGEEYEEQPRPRSK
KKGAKRKAVSGYQSHDDSSDNSECTFPFKYTYGVNAWKHWVKTRQLDEDLLVLDELKSPK
SVKLKEDLLSHTTAELNYGLAHFVNEIRRPNGESYAPDSIYYLCLGIQEYLCGSNRKDNI
FIDPGYQTFEQELNKILRSWQPSILPDGSIFSRVEEDYLWRIKQLGSHSPVALLNTLFYF
NTKYFGLKTVEQHLRLSFGTVFRHWKKNPLTMENKACLRYQVSSLCGTDNEDKITTGKRK
HEDDEPVFEQIENTANPSRCPVKMFECYLSKSPQNLNQRMDVFYLQPECSSSTDSPVWYT
STSLDRNTLENMLVRVLLVKDIYDKDNYELDEDTD
Download sequence
Identical sequences M3YPK7
ENSMPUP00000013265 XP_012904275.1.14098 ENSMPUP00000013265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]