SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012904795.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012904795.1.14098
Domain Number 1 Region: 4-84
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000252
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012904795.1.14098
Sequence length 549
Comment PREDICTED: GRB2-associated-binding protein 3 isoform X2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MSGSPDVLEYYRSKHASKPIRAIDLSECAVWRHVGPGFPRKEFQNNFVFVVKTTSRTFYL
VAKTEVEMLVWVYSISQVCNLGQLEEGADPAESCSRGPPALQPAPGSCLPSGRASSSSRP
RGDLSTDFMATEDSRSESEFLPLPDYLILSNCETGRPRQASLPSRYDSCSTSERSLEQAS
SDDVFVDCPPPAAPAGSGRLLRCGSGSQKVLSLRPQATLTRSRDSTGLARDCCSSPLPEM
PLNATIRVDKNQGLLPYEATEHDLASCPPPPRPPKPSHLSERRQEQPLAGSVRPVGRPES
AAVPRRVSLSGLENVGTWKADVEGQSLRHRDKRLSLNLPCGFSPVYPTAPAGAEDGYVPM
GPQAAGSSLRTPCGHDDYIPMSPGSLSSPLPELPADLEPPPVNRDLKPQRKPRPPPLDLR
NLSTIREHACVTRTCTVPCNRTRFLSPERNGINSARFFANSVSREEEESYIHMNHRAAHS
LSGGTPTWARKSSLDYLALDFNSASPAPAQQKLLVSEEHKVDYVQVDERKTQALRSTRQE
WTDERQSKA
Download sequence
Identical sequences M3YXH8
ENSMPUP00000016038 XP_004779364.1.14098 XP_012904795.1.14098 XP_012904796.1.14098 ENSMPUP00000016038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]