SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012904848.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012904848.1.14098
Domain Number 1 Region: 3-310
Classification Level Classification E-value
Superfamily L domain-like 2.27e-62
Family Internalin LRR domain 0.08
Further Details:      
 
Domain Number 2 Region: 754-860
Classification Level Classification E-value
Superfamily PDZ domain-like 1.04e-25
Family PDZ domain 0.0000507
Further Details:      
 
Domain Number 3 Region: 620-717
Classification Level Classification E-value
Superfamily PDZ domain-like 1.06e-24
Family PDZ domain 0.0000399
Further Details:      
 
Domain Number 4 Region: 903-995
Classification Level Classification E-value
Superfamily PDZ domain-like 7.76e-24
Family PDZ domain 0.0049
Further Details:      
 
Domain Number 5 Region: 996-1093
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-23
Family PDZ domain 0.0000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012904848.1.14098
Sequence length 1523
Comment PREDICTED: protein scribble homolog isoform X7 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MQLVELDVSRNDIPEIPESIKFCKALEIADFSGNPLSRLPEGFTQLRSLAHLALNDVSLQ
ALPGDVGNLANLVTLELRENLLKSLPASLSFLVKLEQLDLGGNELEVLPDTLGALPNLRE
LWLDRNQLSALPPELGNLRRLVCLDVSENRLEELPAELGGLLLLTDLLLSQNLLQRLPDG
IGQLKQLSILKVDQNRLCEVTEAIGDCENLSELVLTENLLTALPRSLGKLTKLTNLNADR
NRLEALPPEIGGCAALSVLSLRDNRLAALPPELAHTAELHVLDVAGNRLRSLPFALTHLN
LKALWLAENQAQPMLRFQTEDDAQTGEKVLTCYLLPQQPPPSLEDPGQQSSPSESRSDVP
PSRVSVIQFLEVPACGDDAEGAAAEKRGLQRRATPHPSELKVLKRGVEERRGEAHSRRPE
SGSPSPLEEDKRLSTESGVSEDSQPSAGTASQGEPEGPSLQEAAPGPQEEAAEESYEEPT
VRFAEDTLLLPPAEDGESEEAPWPLPGGRQRLIRKDTPHYKKHFKISKLPQPEAVVALLQ
GAQPDGEGLGAPSGWHNGPHAPWAPRAEEEEEEEEEEPEEEEEEAVEAEPEEEEEQAATL
VPAPSVKGVSFDPANNLLIEPARIEEEELTLTIVRQTGGLGISIAGGRGSTPYKGGDEGV
FISRVSEEGPAARAGVRVGDKLLEVNGVALHSAEHHQAVEALRGAGSTVRMRLWRERMVE
PENAITVTPLRPEDDYSPREWRGAGLRLPLLQPESAGAPRQRHVACLVRSEKGLGFSIAG
GKGSTPYRAGDGGIFISRIAEGGAAHRAGTLQVGDRVLSINGVDMTEARHDHAVSLLTAA
SPTIALLLEREAGGPLPPSPLPHSPPPPIAATTAVVTATPGESGLLRLAPGLPAAASEGP
YPVEEICLPRAGGPLGLSIVGGSDHSSHPFGIQEPGVFISKVLPRGLAARSGLRVGDRIL
AVNGQDIREATHQEAVSALLRPCLELVLLVRRDPPPPGMRELCIQKAPGEKLGISIRGGA
KGHAGNPCDPTDEGIFISKVSPTGAAGRDGRLRVGLRLLEVNQQSLLGLTHGEAVQLLRG
VGDTLTVLVCDGFDASPTVPAEVSPGVIANPFAAGLGCRNSLESISSIDRELSPEGSAKE
KELPGQTPPWGLEAVGLSSESLKLDYRTLAAVPGAGSVQRVQSGATGGNTTESHCSPSCQ
QPPAPPSPDALPTNVKQAYRTFAAVPGPHPLQDTPTQPPTPGATASPEQLSFRERQKYFE
LEVRVPQAEGPPKRVSLVGADDLRKMQEEEARKLQQKRAQLLREAEEAEAGGLALDLDGE
EQEEPATWASPAAGLSPSSPQPPGGSAPVRTAKAERRQQERLRVQSPELSMQVPDRALSP
AERRALEAEKRALWRAARMKSLEQDALRAQMVLSKSQEGRSRRGPLERLAEAPSPAPTPS
PTPVEDLGPQTSSSPGRLSPDFAEELRSLEPSPSPGLQEEAGEVAVVLLGRPSPATAGPE
EVTLCSSRRPVRPGRRGLGPVPS
Download sequence
Identical sequences M3Y9T4
ENSMPUP00000008091 XP_012904848.1.14098 ENSMPUP00000008091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]