SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012905127.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012905127.1.14098
Domain Number 1 Region: 385-497
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000000000000144
Family PWWP domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012905127.1.14098
Sequence length 696
Comment PREDICTED: PWWP domain-containing protein MUM1L1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MDAEYVLCNWKDQLWPAKVLSRSEMSSNSKRKKTFSLEVQILSLDEKIKVESTETKILNK
SQIEALVSSLEAQSEVSSPPREETAYERSLKAALDILNEKTDLSQASSSDEEATSTLSQN
DLQNLSDSPPRKKYRKHEGDGDLSKCLEESENATSLSVANLENNDSLCDDKSRVHATIDT
LASEMETKSSENSSWYETFPSLSEDEDEKESKKKIDILAVMPLYSTIKEEDVCVKDEKFT
PTWSSDTFIVPKAVKEEAQDICPETLAVSSECSTFSENTEDPGEGPSNPCSSTSQNQPVE
SEAGAAASPRHCSWECQVSLSASNRVLDYSLLLRNNEGNLQRLDFEELGEELQASDKSAQ
LNPIDASILDDNEEDEELPRFVFNYEPRSFETGMIVWFKYQKYPFWPAVVKSIRRKERKA
SVLFVEASMNPEKRGIRVPFRRLKKFDCKEKQALVDKAREEYSESIDWCISLICDYRVRL
GCGSFAGSFLEYYAADISYPLRKVIKQDTFRNLFPKLHNENSAEQMVVTSQTKKMSFQKI
LPDRMKAARDRANKNLVDFIVNAKGTENHLLAILKGKKGSRWLKSFLNSNRFTPCIETYF
EDEDQLDEVVKYLQEIYKQIDEKMLTLIRDDKIKFILEVLLPEAIICSISAVDGLDYKAA
EAKYLKGPSLGCRERELFDSKILFEKRRKPLTNEAH
Download sequence
Identical sequences M3Z580
XP_004780021.1.14098 XP_004780022.1.14098 XP_004780023.1.14098 XP_004780024.1.14098 XP_012905121.1.14098 XP_012905122.1.14098 XP_012905123.1.14098 XP_012905124.1.14098 XP_012905125.1.14098 XP_012905126.1.14098 XP_012905127.1.14098 XP_012905129.1.14098 XP_012905130.1.14098 ENSMPUP00000018742 ENSMPUP00000018742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]