SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012905766.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012905766.1.14098
Domain Number 1 Region: 67-304
Classification Level Classification E-value
Superfamily L domain-like 4.19e-40
Family Ngr ectodomain-like 0.075
Further Details:      
 
Domain Number 2 Region: 787-882
Classification Level Classification E-value
Superfamily DEATH domain 3.7e-18
Family DEATH domain, DD 0.014
Further Details:      
 
Weak hits

Sequence:  XP_012905766.1.14098
Domain Number - Region: 475-517
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 0.0388
Family Actin/HSP70 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012905766.1.14098
Sequence length 915
Comment PREDICTED: p53-induced death domain-containing protein 1 isoform X3 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MAAEAERLEPEAAAPEDAVGEVADAVDGEPGDPHLLLGNRLNLHLYPRGCHRLSQLCAQR
APRLLEVEFLQLSGHEDPRLLEATLAQVPANLQHLRSLVLRGGQQQDVLGACSRGFLTTL
PAGLSGLARLAHLDLSFNSLETLPACVPHMRGLSTLLLSYNRLSELPDSLGALPSLSFLS
VSHNCLRALPPALGSLSALQRLDLSENLLDILPPEIGDLSSLTELNLASNRLQGLPISLV
GLRSLRFLILHSNLLTSVPSGLAHLPLLARLDLRDNQLRDVPPELLDAPFVRLQGNPLGK
ALPASHSAPETPVTCEMPRLFLNSDLDSFLVTPQGCLVTLACGVRLRFPAGATADPVNIH
YRLRLPEPRLVPLGPHDALLSAVLELRPHGVAFQQEVDLWLLFVPPRARRCREVVVRTLS
DDSWSDLETHLEEEAPKRLWAHCQVPHFSWFLVVSRPVSNTCLVPPEGTLLCSSGHPGVK
VTFPPGATDEPRRVRMQVVHMASRELRALLEEPGAAASPLLCLSQRGTASFLQPVTVQLP
LPPGVTGLSLDRTCLHLLYWAPPAAAWDDITAQAALEITHLYARFRVTHFSWYWLWHTTK
SCVQGLARKAWERLRLHQVNLIALQRRRDPEQVLLQCLPRRKVDATLQRLLDRYRGPEPS
DTVEMFEGEKFFAAFEKGIDVDADRPDCVEGRICFVFYSHLKNLKEVYVTTALDRRAQAV
RGQVSFYRGAVSEEVPEEAAAARQRKGADPLWMATLPIKLPRLRGSQGPEQGRGASLSLA
PLNLGDAETGFLTQSNLLNVAGRLGTDWPAVALHLGMPYRELQRIRHEFRDDLDGQIRCM
LFSWAERQAGQPGAVGLLVRALEQSDRLDIAEEVRAILELGRQKYKDSIQRASLAPRDLA
PPKPSASQAPESAQA
Download sequence
Identical sequences M3YCA4
XP_012905766.1.14098 ENSMPUP00000008961 ENSMPUP00000008961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]