SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012906570.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012906570.1.14098
Domain Number 1 Region: 19-226
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-45
Family DBL homology domain (DH-domain) 0.00028
Further Details:      
 
Domain Number 2 Region: 256-450
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.76e-35
Family BAR domain 0.011
Further Details:      
 
Domain Number 3 Region: 592-672
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-19
Family SH3-domain 0.0007
Further Details:      
 
Domain Number 4 Region: 495-568
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000387
Family SH3-domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012906570.1.14098
Sequence length 675
Comment PREDICTED: rho guanine nucleotide exchange factor 37 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MAEHGTDEPSSRTGSPNGEGRASGDRLSLHQRLAVRELIDTELSYLHLLRLCASDIRSRL
QQLPQGDLDVLFSNIDDVIEVNSRFLHDLQETTSREEEQVYLIGNLFLEFQEELERVYRV
YCASYDQALLLVETYRKEPELQREIQSVIEAVVPQAGPSGLSFLLVIPLQRITKYPLLLQ
KILENTVPDASAYPVLQRAVSALQDVNTNINEYKRRKEVASKYARVEQLTLRERLARLNT
HTLSKKTTRLSQLLKQEAGLVPRTEDKEFDDLEERFQWVSLCVTEMKNNVAVYLDNLEAF
LRFRPQECDLDIAGGPVPEYCSLMRELQLQAFPRFKQRLEGLVWQPLCTLVKALAGPQNL
VRKRLDKLLDFERVEEKLLEVGSVTYEEQEARHTYQALNSLLVAELPQLNRLAVRWLGQI
LCTFVGLQRDLAQQVLQRAEGSLAQLPHYHLSEPAFWKLVEDTLGQNGHQLRSFQENFEK
VLPPPTAQPLLPGAERQVQALLSRYGPEKLYQVTSNVSGAGTMDLTLLRGQVVALLQNKD
TKGNSSRWLVDTGGHRGYAPAGKLELYHVISGQEEIKGQEGPHQDSHHLAPEPIPAPVPS
LPTVTQAVAVYPFVARSSHEVSLQAGQLVTVLEAQDKKGNPEWSLVEVNEQKGYVPSSFL
ARAPSPAPWGWSLPS
Download sequence
Identical sequences M3YS30
ENSMPUP00000014140 ENSMPUP00000014140 XP_004737913.2.14098 XP_012906561.1.14098 XP_012906563.1.14098 XP_012906565.1.14098 XP_012906570.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]