SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012906812.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012906812.1.14098
Domain Number 1 Region: 3-350
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.05e-50
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000111
Further Details:      
 
Domain Number 2 Region: 358-486
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 3.26e-31
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000559
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012906812.1.14098
Sequence length 488
Comment PREDICTED: thioredoxin reductase 2, mitochondrial isoform X2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MEGRQNYDLLVIGGGSGGLACAKEAAQLGKKVAVVDYVEPSPRGTRWGLGGTCVNVGCIP
KKLMHQAALLGGMVQDAPHYGWALQPVPHDWATMAEAVQNHVKSLNWGHRVQLQDRKVTY
FNIKASFVDAHTVCGVSKGGKETLLSAEHIIIATGGRPRYPTHIEGALEYGITSDDLFWL
KESPGKTLVVGASYVALECAGFLTGLGLDTTVMIRSIPLRGFDQQMSSLVTEYMASQGTR
FLRGCTPSRVQRLPDGQLQVTWEDPSSGKEDTGTFNTVLWAIGRIPETRSLNLEKAGVHT
SPTSQKILVDALETTSVPHIYAIGDVAEGRPELTPTAIMAGKLLAQRLCGQSSDVMDYEN
VPTTVFTPLEYGCVGLSEEEAVARHGEEHVEVYHAYYKPLEFTVAERDASQCYIKMVCLR
KPPQLVLGLHFLGPNAGEVTQGFALGIKCGASYAQVMRTVGIHPTCAEEVAKLRISKRSG
LDPTVTGC
Download sequence
Identical sequences M3XXU8
ENSMPUP00000003899 ENSMPUP00000003899 XP_012906812.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]