SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012907183.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012907183.1.14098
Domain Number 1 Region: 721-772
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000176
Family Erythroid transcription factor GATA-1 0.0024
Further Details:      
 
Domain Number 2 Region: 1049-1096
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000171
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Weak hits

Sequence:  XP_012907183.1.14098
Domain Number - Region: 522-565
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0365
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012907183.1.14098
Sequence length 1114
Comment PREDICTED: zinc finger transcription factor Trps1 isoform X5 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MPYEVNAGYDFTNMVRKKNPPLRNVASEGEGQSLEPIGTESKVSGKNKEFSADQMSENTD
QSDAAELNNKEEHSSHGQDPSSSSKKGLKSSVLSEKAGFNYESPSKGGNLPSHPHDEVTD
RNMLAFSSPAAGGVCEPLKSPQRAEADDPQDMACTPSGDSLETKEDHKMSPKATEETGQA
QSGQANCQGSSPVSVASKNPQVPSDGGVRLNKSKTDLLVNDIPDPAPLSPELQDFKCNIC
GYGYYGNDPTDLIKHFRKYHLGLHNRTRQDAELDSKILALHNMVQFSHSKDFQKVNRSVL
SGVLQDINSSRPVLLNGTYDVQVTSGGTFIGIGRKTPDCQGNTKYFRCKFCNFTYMGNSS
TELEQHFLQTHPNKIKASLPSSEGAKPSEKNSNKSIPALRSSDSGDLGKWQDKITVKTGD
DTPVGYSVPIKPLDSSRQNAGSSRVKHQCHQCSFSTPDVDVLLFHYESSHESQASEVKQE
ANHLQGSDGQPAVKESKEHSCTKCDFITQVEEEISRHYRRAHSCYKCRQCSFTAADTQSL
LEHFNTVHCHEQDITTANGEEDGHAVSTIKEEPKIDLKVYSLLNPDSKMGEPVSESVVKR
EKVEDKDGLKDKVWTESSSDDLRNMTWRGADILRGSPSYTQASLGLLTPVSGPQEQTKTL
RDSPNVEAAHLARPIYGLAVETKGFLQGVPAGGEKSGTLTQQYPASGENKSKDESQSLLR
RRRGSGVFCANCLTTKTSLWRKNANGGYVCNACGLYQKLHSTPRPLNIIKQNNGEQIIRR
RTRKRLNPEALQAEQLNKQQRGGSEEQVNGSPLERRSEDHLTEGHQREIPLPSLSKYEAQ
GSLTKSHSAQQPVLVSQTLDIHKRMQPLHIQIKSPQESTGDPGNSSSVSEGKGSSERGSP
IEKYMRPAKHPNYSPPGSPIEKYQYPLFGLPFVHNDFQSEADWLRFWSKYKLSVPGNPHY
LSHVPGLPNPCQNYVPYPTFNLPPHFSAVGSDNDIPLDLAIKHSRPGPTANGASKEKTKA
PSNVKSEGPLNVVKTEKVDRSTQDELSTKCVHCGIVFLDEVMYALHMSCHGDSGPFQCSI
CQHLCTDKYDFTTHIQRGLHRNNAQAEKNGKPKE
Download sequence
Identical sequences M3XPH3
XP_012907183.1.14098 ENSMPUP00000000973 ENSMPUP00000000973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]