SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012908131.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012908131.1.14098
Domain Number 1 Region: 29-211
Classification Level Classification E-value
Superfamily Macro domain-like 2.02e-42
Family Macro domain 0.00028
Further Details:      
 
Domain Number 2 Region: 233-406
Classification Level Classification E-value
Superfamily Macro domain-like 1.4e-41
Family Macro domain 0.00045
Further Details:      
 
Domain Number 3 Region: 443-621
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.49e-39
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012908131.1.14098
Sequence length 622
Comment PREDICTED: poly [ADP-ribose] polymerase 15 isoform X2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MSGWLVFMLRGMLKDQVSGKNCLPDGNVIASAQTTEGLNLVLMAGNVTNFQAHVIVNTVS
QTLQLGNGPLSRAILQKAGPKLQEELYAVKQGAVEKIGSIFITSGCNLNCQAVFHVVAPT
WDNAAGRSQQIMANIIKKCLATVEELSFSSIVFPMIGTGNLRFPKAIFANLILSELFEFS
SRSWRKALQKVYLLVHLGDDEIQQAFLDEFTKGLYGNPNKDRILTTEGAFSPISSPGIIS
YGMKIGAITFQIATGDISKEKADVIVNSTTRTFNLKSGVSKAILEGAGPAVENECVVLAA
QPHRDFIVTQGGNLMCKIIIHVLGENDVRKTVSTVLEECEQRKYTSVSLPAIGTGNAGKN
PATVADDMISAVIDFARKHPIPSLRRVKVVIFLLELLHVFYDNMKKREKSTSPVLQPTRF
ETACNLPEHWADMNQQLSCVIELLPGQSEYDTIKDKFSETCPAYEIEKIERIQNVCIWQS
YQIKKNHMDMKNGHTDNERILFHGTDADSVPYVNEHGFNRSYAGKNGAAYGQGTYFAVNA
KYSANDKYSTPDSNGRKHVYVVRVLTGVYTCGHARLVTPPSKNPHNPTDLFDSVTDDTQH
PSLFVVFSDNQAYPEYLITFRC
Download sequence
Identical sequences M3Y042
XP_012908131.1.14098 ENSMPUP00000004693 ENSMPUP00000004693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]