SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012908406.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012908406.1.14098
Domain Number 1 Region: 39-331,514-575
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.91e-91
Family FAD-linked reductases, N-terminal domain 0.00011
Further Details:      
 
Domain Number 2 Region: 333-515
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.63e-57
Family GMC oxidoreductases 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012908406.1.14098
Sequence length 594
Comment PREDICTED: choline dehydrogenase, mitochondrial [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MWRVPRGWRVGRLGPWGAEGRKQPPSVRALASVGSRSGDEYSHVVVGAGSAGCVLARRLT
EDPDKRVLLLEAGPKDVLAGSKRLLWKIHMPAALVANLCDDRYNWCYHTEPQPGLDGRVL
YWPRGRVWGGSSSLNAMVYIRGHAEDYNRWQREGAAGWDYAHCLPYFRKAQSHELGAGTY
RGGQGPLHVSRGKTNHPLHHAFLEAAQQAGYPLTEDMNGFQQEGFGWMDMTIHQGKRWSA
ACAYLHPALGRPNLTAEAQTLVHRVLFEGTRAVGVEYVKNGQSHRVYAGAEVILSGGAIN
SPQLLMLSGVGNADDLRKLGIPVVCHLPGVGQNLQDHLEVYIQQACTRPITLHSAQKPLR
KVRIGLEWLWKFTGDGATAHLETGGFIRSRPGVPHPDIQFHFLPSQVIDHGRVPTQQEAY
QVHVGTMRGTSVGWLKLRSANPQDHPVIQPNYLTTETDIHDFRQCVKLTREIFAQKALAP
FRGKELQPGSNVQSDEEIDAFVRAKADSAYHPSCTCKMGQPSDPMAVVDPQTRVLGVQNL
RVVDASIMPSVVSGNLNAPTIMIAEKAADIIRGQPALWDKDVPVYKPGTLATQR
Download sequence
Identical sequences M3YZF8
XP_004738257.1.14098 XP_012908401.1.14098 XP_012908406.1.14098 ENSMPUP00000016718 ENSMPUP00000016718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]